Recombinant human IL1 alpha protein (ab119165)

Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionP01583
    • SpeciesHuman
    • SequenceSAPFSFLSNVKYNFMRIIKYEFILNDALNQSIIRANDQYLTAAALHNLDE AVKFDMGAYKSSKDDAKITVILRISKYQLYVTAQDEDQPVLLKEMPEKPK TITGSETNLLFFWETHGTKNYFTSVAHPNLFIATKQDYWVCLAGGPPSIT DFQILENQA
    • Molecular weight18 kDa
    • Amino acids113 to 271

Associated products

Specifications

Our Abpromise guarantee covers the use of ab119165 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activityThe activity is determined by the stimulation of D10S.G4.1 cells and is typically 1-6 pg/ml.
  • Applications

    SDS-PAGE

    HPLC

    Functional Studies

  • Endotoxin level< 0.100 Eu/µg
  • FormLyophilised
  • Additional notesIt is recommended that a carrier protein (0.1% HSA or BSA) is added for long term storage.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. After reconstitution store at -20ºC. Avoid freeze / thaw cycles.

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • ReconstitutionLyophilised product is very stable at -20°C. Centrifuge vial before opening. When reconstituting ab119165, gently pipette and wash down the sides of the vial to ensure full recovery of the protein into solution. It is recommended to reconstitute the lyophilised product with sterile water at a concentration of 0.1 mg/ml, which can be further diluted into other aqueous solutions.

General Info

  • Alternative names
    • BAF
    • FAF
    • Hematopoietin 1
    • Hematopoietin-1
    • IL 1 alpha
    • IL 1A
    • IL-1 alpha
    • Il-1a
    • IL1
    • IL1 ALPHA
    • IL1A
    • IL1A_HUMAN
    • IL1F1
    • Interleukin 1 alpha
    • Interleukin-1 alpha
    • Interleukin1 alpha
    • LAF
    • LEM
    • Preinterleukin 1 alpha
    • Pro interleukin 1 alpha
    see all
  • FunctionProduced by activated macrophages, IL-1 stimulates thymocyte proliferation by inducing IL-2 release, B-cell maturation and proliferation, and fibroblast growth factor activity. IL-1 proteins are involved in the inflammatory response, being identified as endogenous pyrogens, and are reported to stimulate the release of prostaglandin and collagenase from synovial cells.
  • Sequence similaritiesBelongs to the IL-1 family.
  • DomainThe similarity among the IL-1 precursors suggests that the amino ends of these proteins serve some as yet undefined function.
  • Cellular localizationSecreted. The lack of a specific hydrophobic segment in the precursor sequence suggests that IL-1 is released by damaged cells or is secreted by a mechanism differing from that used for other secretory proteins.
  • Information by UniProt

Recombinant human IL1 alpha protein images

  • ab119165 used in Functional Studies.

References for Recombinant human IL1 alpha protein (ab119165)

ab119165 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab119165.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"