Recombinant human IL1 alpha protein (ab73567)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      SAPFSFLSNVKYNFMRIIKYEFILNDALNQSIIRANDQYLTAAALHNLDE AV KFDMGAYKSSKDDAKITVILRISKTQLYVTAQDEDQPVLLKEMPEI PKTITG SETNLLFFWETHGTKNYFTSVAHPNLFIATKQDYWVCLAGGPPSIT DFQILE NQA
    • Molecular weight
      18 kDa
    • Amino acids
      113 to 271
    • Additional sequence information
      Interleukin-1 alpha Human Recombinant produced in E.Coli is single, a non-glycosylated, Polypeptide chain containing 159 amino acids and having a molecular mass of 18022 Dalton.

Specifications

Our Abpromise guarantee covers the use of ab73567 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity
    Specific Activity: 1 x 109 IU/mg.
  • Applications

    Functional Studies

    SDS-PAGE

    Western blot

  • Purity
    > 95 % SDS-PAGE.
    ab73567 is purified by proprietary chromatographic techniques. Purity greater than 98.0% as determined by: (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
  • Form
    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 10% Glycerol, 5mM Magnesium chloride, 20mM Tris HCl, pH 8.0

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    Reconstitute in sterile 18Mohm/cm H2O at not less than 100µg/ml, which can then be further diluted to other aqueous solutions.

General Info

  • Alternative names
    • BAF
    • FAF
    • Hematopoietin 1
    • Hematopoietin-1
    • IL 1 alpha
    • IL 1A
    • IL-1 alpha
    • Il-1a
    • IL1
    • IL1 ALPHA
    • IL1A
    • IL1A_HUMAN
    • IL1F1
    • Interleukin 1 alpha
    • Interleukin-1 alpha
    • Interleukin1 alpha
    • LAF
    • LEM
    • Preinterleukin 1 alpha
    • Pro interleukin 1 alpha
    see all
  • Function
    Produced by activated macrophages, IL-1 stimulates thymocyte proliferation by inducing IL-2 release, B-cell maturation and proliferation, and fibroblast growth factor activity. IL-1 proteins are involved in the inflammatory response, being identified as endogenous pyrogens, and are reported to stimulate the release of prostaglandin and collagenase from synovial cells.
  • Sequence similarities
    Belongs to the IL-1 family.
  • Domain
    The similarity among the IL-1 precursors suggests that the amino ends of these proteins serve some as yet undefined function.
  • Cellular localization
    Secreted. The lack of a specific hydrophobic segment in the precursor sequence suggests that IL-1 is released by damaged cells or is secreted by a mechanism differing from that used for other secretory proteins.
  • Information by UniProt

References

ab73567 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab73567.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up