Recombinant human IL1 alpha protein (ab73567)

Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • SpeciesHuman
    • SequenceSAPFSFLSNVKYNFMRIIKYEFILNDALNQSIIRANDQYLTAAALHNLDE AV KFDMGAYKSSKDDAKITVILRISKTQLYVTAQDEDQPVLLKEMPEI PKTITG SETNLLFFWETHGTKNYFTSVAHPNLFIATKQDYWVCLAGGPPSIT DFQILE NQA
    • Molecular weight18 kDa
    • Amino acids113 to 271
    • Additional sequence informationInterleukin-1 alpha Human Recombinant produced in E.Coli is single, a non-glycosylated, Polypeptide chain containing 159 amino acids and having a molecular mass of 18022 Dalton.

Specifications

Our Abpromise guarantee covers the use of ab73567 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activitySpecific Activity: 1 x 109 IU/mg.
  • Applications

    Functional Studies

    SDS-PAGE

    Western blot

  • Purity> 95 % SDS-PAGE.
    ab73567 is purified by proprietary chromatographic techniques. Purity greater than 98.0% as determined by: (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
  • FormLyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 10% Glycerol, 5mM Magnesium chloride, 20mM Tris HCl, pH 8.0

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • ReconstitutionReconstitute in sterile 18Mohm/cm H2O at not less than 100µg/ml, which can then be further diluted to other aqueous solutions.

General Info

  • Alternative names
    • BAF
    • FAF
    • Hematopoietin 1
    • Hematopoietin-1
    • IL 1 alpha
    • IL 1A
    • IL-1 alpha
    • Il-1a
    • IL1
    • IL1 ALPHA
    • IL1A
    • IL1A_HUMAN
    • IL1F1
    • Interleukin 1 alpha
    • Interleukin-1 alpha
    • Interleukin1 alpha
    • LAF
    • LEM
    • Preinterleukin 1 alpha
    • Pro interleukin 1 alpha
    see all
  • FunctionProduced by activated macrophages, IL-1 stimulates thymocyte proliferation by inducing IL-2 release, B-cell maturation and proliferation, and fibroblast growth factor activity. IL-1 proteins are involved in the inflammatory response, being identified as endogenous pyrogens, and are reported to stimulate the release of prostaglandin and collagenase from synovial cells.
  • Sequence similaritiesBelongs to the IL-1 family.
  • DomainThe similarity among the IL-1 precursors suggests that the amino ends of these proteins serve some as yet undefined function.
  • Cellular localizationSecreted. The lack of a specific hydrophobic segment in the precursor sequence suggests that IL-1 is released by damaged cells or is secreted by a mechanism differing from that used for other secretory proteins.
  • Information by UniProt

Recombinant human IL1 alpha protein images

  • Anti-IL1 alpha antibody (ab9614) at 1 µg/ml + Recombinant human IL1 alpha protein (ab73567) at 0.01 µg

    Secondary
    Goat Anti-Rabbit IgG H&L (HRP) preadsorbed (ab97080) at 1/5000 dilution
    Developed using the ECL technique

    Performed under reducing conditions.

    Exposure time : 30 seconds

References for Recombinant human IL1 alpha protein (ab73567)

ab73567 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab73567.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"