Recombinant Human IL1 Receptor I protein (Fc Chimera) (ab83575)

Overview

Description

  • Nature
    Recombinant
  • Source
    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      Theoretical Sequence: LEADKCKEREEKIILVSSANEIDVRPCPLNPNEHKGTIT WYKDDSKTP VSTEQASRIHQHKEKLWFVPAKVEDSGHYYCVVRNSSYC LRIKISAKF VENEPNLCYNAQAIFKQKLPVAGDGGLVCPYMEFFKNEN NELPKLQWY KDCKPLLLDNIHFSGVKDRLIVMNVAEKHRGNYTCHASY TYLGKQYPI TRVIEFITLEENKPTRPVIVSPANETMEVDLGSQIQLIC NVTGQLSDI AYWKWNGSVIDEDDPVLGEDYYSVENPANKRRSTLITVL NISEIESRF YKHPFTCFAKNTHGIDAAYIQLIYPVTNRSSNTKVDKKV EPKSCDKTH TCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVV VDVSHEDPE VKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQ DWLNGKEYK CRVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELT KNQVSLTCL VKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLY SKLTVDKSR WQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
    • Amino acids
      18 to 333
    • Additional sequence information
      A DNA sequence encoding the signal peptide and extracellular domain of human IL-1RI (aa 1-333) was fused to the Fc region of human IgG1 (aa 93-330). Protein expressed in modified human 293 cells.

Associated products

Specifications

Our Abpromise guarantee covers the use of ab83575 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity
    > 95 % SDS-PAGE.

  • Form
    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. After reconstitution store at -20ºC. Avoid freeze / thaw cycles.

    Preservative: None
    Constituents: 10% Trehalose, 1% Human serum albumin

  • Reconstitution
    It is recommended that 0.5 ml of sterile phosphate-buffered saline be added to the vial. Following reconstitution short-term storage at 4°C is recommended, and longer-term storage of aliquots at -18 to -20°C. Repeated freeze thawing is not recommended.

General Info

  • Alternative names
    • Antigen CD121a
    • CD121 antigen-like family member A
    • CD121a
    • CD121a antigen
    • D2S1473
    • IL 1
    • IL 1R 1
    • IL 1R alpha
    • IL 1RT1
    • IL-1R-1
    • IL-1R-alpha
    • IL-1RT-1
    • IL-1RT1
    • IL1 inhibitor
    • IL1R
    • IL1R1
    • IL1R1_HUMAN
    • IL1RA
    • IL1RN
    • IL1RT1
    • Interleukin 1 receptor alpha type 1
    • Interleukin 1 receptor antagonist protein (IRAP)
    • Interleukin 1 receptor type I
    • Interleukin receptor 1
    • Interleukin-1 receptor alpha
    • Interleukin-1 receptor type 1
    • Interleukin-1 receptor type I
    • p80
    see all
  • Function
    Receptor for interleukin-1 alpha (IL-1A), beta (IL-1B), and interleukin-1 receptor antagonist protein (IL-1RA). Binding to the agonist leads to the activation of NF-kappa-B. Signaling involves formation of a ternary complex containing IL1RAP, TOLLIP, MYD88, and IRAK1 or IRAK2.
  • Sequence similarities
    Belongs to the interleukin-1 receptor family.
    Contains 3 Ig-like C2-type (immunoglobulin-like) domains.
    Contains 1 TIR domain.
  • Cellular localization
    Membrane.
  • Information by UniProt

Images

  • Densitometry of protein isoforms visualised by 2-DE. Spot trains are normal in human proteins and highlight the presence of multiple isoforms which differ according to their level of post-translational modification. The triangle indicates the theoretical MW and pI of the protein.
  • 1D SDS-PAGE of ab83575 before and after treatment with glycosidases to remove oligosaccharides.
    Lane 1 – MW markers; Lane 2 – ab83575; Lane 3 – ab83575 treated with PNGase F to remove potential N-linked glycans; Lane 4 – ab83575 treated with a glycosidase cocktail to remove potential N- and O-linked glycans. 10 µg protein loaded per lane.

    Drop in MW after treatment with PNGase F indicates presence of N-linked glycans. Additional bands in lane 3 and lane 4 are glycosidase enzymes.

References

ab83575 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab83575.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up