Recombinant Human IL12 p35 protein (ab158760)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      CLASRKTSFMMALCLSSIYEDLKMYQVEFKTMNAKLLMDPKRQIFLDQNM LAVIDELMQALNFNSETVPQKSSLEEPDFYKTKIKLCILLHAFRIRAVTI DRVMSYLNAS
    • Amino acids
      144 to 253
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158760 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CLMF
    • CLMF p35
    • Cytotoxic lymphocyte maturation factor 35 kDa subunit
    • IL-12 subunit p35
    • IL-12A
    • IL12 subunit p35
    • IL12A
    • IL12A_HUMAN
    • Interleukin 12 p35
    • Interleukin 12A
    • Interleukin-12 subunit alpha
    • NFSK
    • NK cell stimulatory factor chain 1
    • NKSF1
    see all
  • Function
    Cytokine that can act as a growth factor for activated T and NK cells, enhance the lytic activity of NK/lymphokine-activated Killer cells, and stimulate the production of IFN-gamma by resting PBMC.
  • Sequence similarities
    Belongs to the IL-6 superfamily.
  • Cellular localization
    Secreted.
  • Information by UniProt

Images

  • ab158760 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158760 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158760.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up