Recombinant human IL12 p70 protein (BSA and azide free) (ab181891)

Overview

  • Product name
    Recombinant human IL12 p70 protein (BSA and azide free)
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Baculovirus infected insect cells
  • Amino Acid Sequence 1
    • Accession
    • Species
      Human
    • Sequence
      MCHQQLVISWFSLVFLASPLVAIWELKKDVYVVELDWYPDAPGEMVVLTC DTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHS LLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTIST DLTFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACP AAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSR QVEVSWEYPDTWSTPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSATVIC RKNASISVRAQDRYYSSSWSEWASVPCS
    • Amino acids
      1 to 328
    Amino Acid Sequence 2
    • Accession
    • Species
      Human
    • Sequence
      MWPPGSASQPPPSPAAATGLHPAARPVSLQCRLSMCPARSLLLVATLVLL DHLSLARNLPVATPDPGMFPCLHHSQNLLRAVSNMLQKARQTLEFYPCTS EEIDHEDITKDKTSTVEACLPLELTKNESCLNSRETSFITNGSCLASRKT SFMMALCLSSIYEDLKMYQVEFKTMNAKLLMDPKRQIFLDQNMLAVIDEL MQALNFNSETVPQKSSLEEPDFYKTKIKLCILLHAFRIRAVTIDRVMSYL NAS
    • Amino acids
      1 to 253
    • Additional sequence information
      The heterodimeric, p40, amino acids ile 23-ser 328, cystine linked to p35, amino acids arg 57-ser 253, has a predicted molecular mass of 57,239 Da.

Specifications

Our Abpromise guarantee covers the use of ab181891 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity

    Measured by dose ­dependent induction of proliferation of PHA­ activated human peripheral blood mononuclear cells. The ED50 is 100 pg/ml, corresponding to a specific activity of 1.0 x 107 Units/mg.

  • Applications

    Sandwich ELISA

    Functional Studies

    SDS-PAGE

  • Purity
    > 98 % SDS-PAGE.
    ab181891 is 0.22 µm filtered.
  • Form
    Liquid
  • Additional notes

    Endotoxin Level: Less than 0.01 ng/ug cytokine as determined by the LAL assay.

    For greatest stability, keep concentration of primary stock at or above 10 µg/ml.

    For dilution of current stock, always include carrier protein (1% BSA or 10% FBS) in the buffered saline diluent.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 6.00
    Constituents: 1.17% Sodium chloride, 0.24% Monobasic dihydrogen sodium phosphate

    Contains no carriers or stabilizers.

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names
    • IL12A
    • IL12B
    • CLMF p35
    • CLMF p40
    • Cytotoxic lymphocyte maturation factor 35 kDa subunit
    • Cytotoxic lymphocyte maturation factor 40 kDa subunit
    • Interleukin 12 alpha chain
    • Interleukin-12 beta chain
    • NK cell stimulatory factor chain 1
    • NK cell stimulatory factor chain 2
    • NKSF1
    • NKSF2
    see all
  • Relevance
    IL12 p70 is a disulfide bonded heterodimer of the IL12 40 kDa and 35 kDa subunits.
  • Cellular localization
    Secreted

References

ab181891 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab181891.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up