Recombinant Human IL12RB2 protein (ab116889)

Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionQ99665
    • SpeciesHuman
    • SequenceCINSDEIQICGAEIFVGVAPEQPQNLSCIQKGEQGTVACTWERGRDTHLY TEYTLQLSGPKNLTWQKQCKDIYCDYLDFGINLTPESPESNFTAKVTAVN SLGSSSSLPS
    • Molecular weight38 kDa
    • Amino acids105 to 214

Specifications

Our Abpromise guarantee covers the use of ab116889 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

    ELISA

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml. This protein is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • I12R2_HUMAN
    • IL-12 receptor subunit beta-2
    • IL-12R subunit beta-2
    • IL-12R-beta-2
    • IL-12RB2
    • IL12 receptor beta 2
    • IL12R beta2
    • IL12RB2
    • Interleukin 12 receptor beta 2
    • Interleukin 12 receptor beta 2 chain
    • Interleukin-12 receptor subunit beta-2
    • RP11 102M16.1
    see all
  • FunctionReceptor for interleukin-12. This subunit is the signaling component coupling to the JAK2/STAT4 pathway. Promotes the proliferation of T-cells as well as NK cells. Induces the promotion of T-cells towards the Th1 phenotype by strongly enhancing IFN-gamma production.
  • Tissue specificityIsoform 2 is expressed at similar levels in both naive and activated T-cells.
  • Sequence similaritiesBelongs to the type I cytokine receptor family. Type 2 subfamily.
    Contains 5 fibronectin type-III domains.
  • Developmental stageMaximum levels in Th1 cells between day 3 and day 8 of activation.
  • DomainThe WSXWS motif appears to be necessary for proper protein folding and thereby efficient intracellular transport and cell-surface receptor binding.
    The box 1 motif is required for JAK interaction and/or activation.
  • Post-translational
    modifications
    On IL12 binding, phosphorylated on C-terminal tyrosine residues by JAK2. Phosphorylation on Tyr-800 is required for STAT4 binding and activation, and for SOCS3 binding.
  • Cellular localizationMembrane.
  • Information by UniProt

Recombinant Human IL12RB2 protein images

  • 12.5% SDS-PAGE showing ab116889 at approximately 37.73kDa stained with Coomassie Blue.

References for Recombinant Human IL12RB2 protein (ab116889)

ab116889 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab116889.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"