Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • SpeciesHuman
    • SequenceGPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTAGMYCAALESL INVS GCSAIEKTQRMLSGFCPHKVSAGQFSSLHVRDTKIEVAQFVKDL LLHLKKLFRE GRFN.
    • Amino acids21 to 132

Specifications

Our Abpromise guarantee covers the use of ab73624 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Functional Studies

  • Purity> 95 % SDS-PAGE.
    Purified by proprietary chromatographic techniques. Purity is greater than 95% as determined by: (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
  • FormLyophilised
  • Additional notesFor long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle.

    Preservative: None
    Constituents: PBS, pH 7.2

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • ReconstitutionReconstitute in sterile 18MOhm/cm water at not less than 100µg/ml, which can then be further diluted to other aqueous solutions.

General Info

  • Alternative names
    • Allergic rhinitis
    • ALRH
    • BHR1
    • Bronchial hyperresponsiveness 1 (bronchial asthma)
    • IL 13
    • IL-13
    • Il13
    • IL13_HUMAN
    • Interleukin 13
    • Interleukin-13
    • MGC116786
    • MGC116788
    • MGC116789
    • NC30
    • P600
    see all
  • FunctionCytokine (PubMed:8096327, PubMed:8097324). Inhibits inflammatory cytokine production (PubMed:8096327). Synergizes with IL2 in regulating interferon-gamma synthesis (PubMed:8096327). May be critical in regulating inflammatory and immune responses (PubMed:8096327, PubMed:8097324). Positively regulates IL31RA expression in macrophages.
  • Involvement in diseaseAllergic rhinitis
  • Sequence similaritiesBelongs to the IL-4/IL-13 family.
  • Cellular localizationSecreted.
  • Information by UniProt

References for Recombinant human IL13 protein (ab73624)

ab73624 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab73624.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"