Recombinant Human IL13 receptor alpha 2 protein (ab114368)

Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionQ14627
    • SpeciesHuman
    • SequenceDTEIKVNPPQDFEIVDPGYLGYLYLQWQPPLSLDHFKECTVEYELKYRNI GSETWKTIITKNLHYKDGFDLNKGIEAKIHTLLPWQCTNGSEVQSSWAET
    • Molecular weight37 kDa including tags
    • Amino acids27 to 126

Specifications

Our Abpromise guarantee covers the use of ab114368 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

    SDS-PAGE

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml. Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Cancer/testis antigen 19
    • CD213a2
    • CT19
    • I13R2_HUMAN
    • IL-13 receptor subunit alpha-2
    • IL-13R subunit alpha-2
    • IL-13R-alpha-2
    • IL-13RA2
    • IL13 receptor
    • IL13BP
    • IL13R
    • Il13ra2
    • Interleukin 13 binding protein
    • Interleukin 13 receptor alpha 2 chain
    • Interleukin-13 receptor subunit alpha-2
    • Interleukin-13-binding protein
    see all
  • FunctionBinds as a monomer with high affinity to interleukin-13 (IL13), but not to interleukin-4 (IL4).
  • Sequence similaritiesBelongs to the type I cytokine receptor family. Type 5 subfamily.
    Contains 1 fibronectin type-III domain.
  • DomainThe WSXWS motif appears to be necessary for proper protein folding and thereby efficient intracellular transport and cell-surface receptor binding.
    The box 1 motif is required for JAK interaction and/or activation.
  • Cellular localizationMembrane.
  • Information by UniProt

Recombinant Human IL13 receptor alpha 2 protein images

  • 12.5% SDS-PAGE showing ab114368 at approximately 36.63kDa stained with Coomassie Blue.

References for Recombinant Human IL13 receptor alpha 2 protein (ab114368)

ab114368 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114368.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"