Recombinant Human IL15RA protein (ab114831)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      ITCPPPMSVEHADIWVKSYSLYSRERYICNSGFKRKAGTSSLTECVLNKA TNVAHWTTPSLKCIRDPALVHQRPAPPSTVTTAGVTPQPESLSPSGKEPA
    • Molecular weight
      37 kDa including tags
    • Amino acids
      31 to 130

Specifications

Our Abpromise guarantee covers the use of ab114831 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • AA690181
    • CD215
    • I15RA_HUMAN
    • IL 15R alpha
    • IL-15 receptor subunit alpha
    • IL-15R-alpha
    • IL-15RA
    • Il15ra
    • Interleukin 15 receptor alpha
    • Interleukin 15 receptor subunit alpha
    • MGC104179
    • sIL-15 receptor subunit alpha
    • sIL-15R-alpha
    • sIL-15RA
    • Soluble interleukin 15 receptor subunit alpha
    • Soluble interleukin-15 receptor subunit alpha
    see all
  • Function
    Receptor for interleukin-15. Expression of different isoforms may alter or interfere with signal transduction. Isoform 5, isoform 6, isoform 7 and isoform 8 do not bind IL15. Signal transduction involves STAT3, STAT5, STAT6, JAK2 (By similarity) and SYK.
  • Tissue specificity
    Isoform 1, isoform 3, isoform 4, isoform 5, isoform 6, isoform 7, isoform 8 and isoform 9 are widely expressed. Expressed in fetal brain with higher expression in the hippocampus and cerebellum than in cortex and thalamus. Higher levels of soluble sIL-15RA form in comparison with membrane-bound forms is present in all brain structures.
  • Sequence similarities
    Contains 1 Sushi (CCP/SCR) domain.
  • Post-translational
    modifications
    A soluble form (sIL-15RA) arises from proteolytic shedding of the membrane-anchored receptor. The cleavage involves ADAM17/TACE (By similarity). It also binds IL-15 and thus interferes with IL-15 binding to the membrane receptor.
    Phosphorylated by activated SYK.
    N-glycosylated and O-glycosylated.
  • Cellular localization
    Secreted > extracellular space; Membrane. Nucleus membrane. Mainly found associated with the nuclear membrane and Endoplasmic reticulum membrane. Golgi apparatus membrane. Cytoplasmic vesicle membrane. Membrane. Isoform 5, isoform 6, isoform 7 and isoform 8 are associated with endoplasmic reticulum, Golgi and cytoplasmic vesicles, but not with the nuclear membrane.
  • Information by UniProt

Images

  • ab114831 analyzed on a 12.5% SDS-PAGE gel stained with Coomassie Blue.

References

ab114831 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab114831.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up