Recombinant Human IL15RA protein (ab114831)

Overview

  • Product nameRecombinant Human IL15RA protein
  • Protein lengthProtein fragment

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionQ13261
    • SpeciesHuman
    • SequenceITCPPPMSVEHADIWVKSYSLYSRERYICNSGFKRKAGTSSLTECVLNKA TNVAHWTTPSLKCIRDPALVHQRPAPPSTVTTAGVTPQPESLSPSGKEPA
    • Molecular weight37 kDa including tags
    • Amino acids31 to 130

Associated products

Specifications

Our Abpromise guarantee covers the use of ab114831 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • AA690181
    • CD215
    • I15RA_HUMAN
    • IL 15R alpha
    • IL-15 receptor subunit alpha
    • IL-15R-alpha
    • IL-15RA
    • Il15ra
    • Interleukin 15 receptor alpha
    • Interleukin 15 receptor subunit alpha
    • MGC104179
    • sIL-15 receptor subunit alpha
    • sIL-15R-alpha
    • sIL-15RA
    • Soluble interleukin 15 receptor subunit alpha
    • Soluble interleukin-15 receptor subunit alpha
    see all
  • FunctionReceptor for interleukin-15. Expression of different isoforms may alter or interfere with signal transduction. Isoform 5, isoform 6, isoform 7 and isoform 8 do not bind IL15. Signal transduction involves STAT3, STAT5, STAT6, JAK2 (By similarity) and SYK.
  • Tissue specificityIsoform 1, isoform 3, isoform 4, isoform 5, isoform 6, isoform 7, isoform 8 and isoform 9 are widely expressed. Expressed in fetal brain with higher expression in the hippocampus and cerebellum than in cortex and thalamus. Higher levels of soluble sIL-15RA form in comparison with membrane-bound forms is present in all brain structures.
  • Sequence similaritiesContains 1 Sushi (CCP/SCR) domain.
  • Post-translational
    modifications
    A soluble form (sIL-15RA) arises from proteolytic shedding of the membrane-anchored receptor. The cleavage involves ADAM17/TACE (By similarity). It also binds IL-15 and thus interferes with IL-15 binding to the membrane receptor.
    Phosphorylated by activated SYK.
    N-glycosylated and O-glycosylated.
  • Cellular localizationSecreted > extracellular space; Membrane. Nucleus membrane. Mainly found associated with the nuclear membrane and Endoplasmic reticulum membrane. Golgi apparatus membrane. Cytoplasmic vesicle membrane. Membrane. Isoform 5, isoform 6, isoform 7 and isoform 8 are associated with endoplasmic reticulum, Golgi and cytoplasmic vesicles, but not with the nuclear membrane.
  • Information by UniProt

Recombinant Human IL15RA protein images

  • ab114831 analyzed on a 12.5% SDS-PAGE gel stained with Coomassie Blue.

References for Recombinant Human IL15RA protein (ab114831)

ab114831 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114831.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"