Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      PDLNSSTDSAASASAASDVSVESTAEATVCTVTLEKMSAGLGFSLEGGKG SLHGDKPLTINRIFKGAASEQSETVQPGDEILQLGGTAMQGLTRFEAWNI IKALPDGPVTIVIRRKSLQSKETTAAGDS

Associated products

Specifications

Our Abpromise guarantee covers the use of ab9564 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Functional Studies

  • Endotoxin level
    < 0.100 Eu/µg
  • Form
    Lyophilised
  • Additional notes
    The biological activity of this product is determined by its ability to chemoattract human CD4 positive T lymphocytes using a concentration range of 1.0-100 ng/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Preservative: None
    Constituents: 5mM Sodium citrate, 0.5mM DTT, pH 5.5

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    Reconstitute with distilled water to achieve desired concentration.

General Info

  • Alternative names
    • HGNC:5980
    • HsT19289
    • IL-16
    • IL16
    • IL16_HUMAN
    • Interleukin 16 precursor
    • Interleukin-16
    • LCF
    • Lymphocyte chemoattractant factor
    • Neuronal interleukin 16
    • NIL16
    • prIL 16
    • PrIL16
    • Prointerleukin 16
    see all
  • Function
    Interleukin-16 stimulates a migratory response in CD4+ lymphocytes, monocytes, and eosinophils. Primes CD4+ T-cells for IL-2 and IL-15 responsiveness. Also induces T-lymphocyte expression of interleukin 2 receptor. Ligand for CD4.
    Isoform 1 may act as a scaffolding protein that anchors ion channels in the membrane.
    Isoform 3 is involved in cell cycle progression in T-cells. Appears to be involved in transcriptional regulation of SKP2 and is probably part of a transcriptional repression complex on the core promoter of the SKP2 gene. May act as a scaffold for GABPB1 (the DNA-binding subunit the GABP transcription factor complex) and HDAC3 thus maintaining transcriptional repression and blocking cell cycle progression in resting T-cells.
  • Tissue specificity
    Isoform 3 is expressed in hemopoietic tissues, such as resting T-cells, but is undetectable during active T cell proliferation.
  • Sequence similarities
    Contains 4 PDZ (DHR) domains.
  • Post-translational
    modifications
    Isoform 3 is synthesized as a chemo-attractant inactive precursor in hemopoietic tissues and is proteolytically cleaved by caspase-3 to yield IL-16.
  • Cellular localization
    Cytoplasm; Cytoplasm. Nucleus and Secreted.
  • Information by UniProt

References

ab9564 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab9564.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up