Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MIVKAGITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYN RSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQE ILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVAMRKIPKVGHTFFQ KPESCPPVPGGSMKLDIGIINENQRVSMSRNIESRSTSPWNYTVTWDPNR YPSEVVQAQCRNLGCINAQGKEDISM-NSVPIQQETLVVRRKHQGCSVSF QLEKVLVTVGCTCVTPVIHHVQ
    • Molecular weight
      31 kDa
    • Amino acids
      20 to 155

Specifications

Our Abpromise guarantee covers the use of ab119440 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity
    The ED50 of recombinant Human IL17, as determined by the production of IL6 by NIH3T3 cells, was typically found to be 3-15 ng/ml.
  • Applications

    SDS-PAGE

    HPLC

    Functional Studies

  • Purity
    > 95 % SDS-PAGE.
    ab119440 is purified by proprietary chromatographic techniques. Purity is > 98 % by SDS-PAGE and HPLC.
  • Form
    Lyophilised
  • Additional notes
    Endotoxin level is <0.1 ng/µg.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20ºC.

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    Centrifuge the vial prior to opening. Reconstitute with sterile water to a concentration of 0.1 mg/ml, the solution can then be diluted into other aqueous buffers. For long term storage it is recommended to add a carrier protein (0.1 % HSA or BSA).

General Info

  • Alternative names
    • CTLA 8
    • CTLA-8
    • CTLA8
    • Cytotoxic T lymphocyte associated antigen 8
    • Cytotoxic T lymphocyte associated protein 8
    • Cytotoxic T lymphocyte associated serine esterase 8
    • Cytotoxic T-lymphocyte-associated antigen 8
    • IL 17A
    • IL-17
    • IL-17A
    • IL17
    • IL17_HUMAN
    • Il17a
    • Interleukin 17 (cytotoxic T lymphocyte associated serine esterase 8)
    • Interleukin 17A
    • Interleukin-17A
    • Interleukin17
    • Interleukin17A
    • OTTHUMP00000016597
    • OTTMUSP00000046003
    see all
  • Function
    Ligand for IL17RA and IL17RC (PubMed:17911633). The heterodimer formed by IL17A and IL17F is a ligand for the heterodimeric complex formed by IL17RA and IL17RC (PubMed:18684971). Involved in inducing stromal cells to produce proinflammatory and hematopoietic cytokines (PubMed:8676080).
  • Tissue specificity
    Restricted to activated memory T-cells.
  • Sequence similarities
    Belongs to the IL-17 family.
  • Post-translational
    modifications
    Found both in glycosylated and nonglycosylated forms.
  • Cellular localization
    Secreted.
  • Information by UniProt

References for Recombinant human IL17 protein (ab119440)

ab119440 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab119440.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up