Overview

Description

  • NatureRecombinant
  • SourceHEK 293 cells
  • Amino Acid Sequence
    • SpeciesHuman
    • SequenceTheoretical sequence: GITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKR SSDYYNRSTSPWNLHRNEDPE RYPSVIWEAKCRHLGCINADGNVDYHM NSVPIQQEILVLRREPPHCPNSFRLEKILVSVGC TCVTPIVHHVA

Specifications

Our Abpromise guarantee covers the use of ab83769 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activityThe activity of IL17 is measured by its ability to induce IL6 production in NHDF cells. The ED50 is typically between 0.5 and 1.5 ng/ml.
  • Applications

    SDS-PAGE

  • Purity> 95 % SDS-PAGE.

  • FormLyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. After reconstitution store at -20ºC. Avoid freeze / thaw cycles.

    Preservative: None
    Constituents: 10% Trehalose, 1% Human serum albumin

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • ReconstitutionIt is recommended that 0.5 ml of sterile phosphate-buffered saline be added to the vial. Following reconstitution short-term storage at 4°C and longer-term storage of aliquots at -18 to -20°C is recommended. Repeated freeze thawing is not recommended.

General Info

  • Alternative names
    • CTLA 8
    • CTLA-8
    • CTLA8
    • Cytotoxic T lymphocyte associated antigen 8
    • Cytotoxic T lymphocyte associated protein 8
    • Cytotoxic T lymphocyte associated serine esterase 8
    • Cytotoxic T-lymphocyte-associated antigen 8
    • IL 17A
    • IL-17
    • IL-17A
    • IL17
    • IL17_HUMAN
    • Il17a
    • Interleukin 17 (cytotoxic T lymphocyte associated serine esterase 8)
    • Interleukin 17A
    • Interleukin-17A
    • Interleukin17
    • Interleukin17A
    • OTTHUMP00000016597
    • OTTMUSP00000046003
    see all
  • FunctionLigand for IL17RA and IL17RC (PubMed:17911633). The heterodimer formed by IL17A and IL17F is a ligand for the heterodimeric complex formed by IL17RA and IL17RC (PubMed:18684971). Involved in inducing stromal cells to produce proinflammatory and hematopoietic cytokines (PubMed:8676080).
  • Tissue specificityRestricted to activated memory T-cells.
  • Sequence similaritiesBelongs to the IL-17 family.
  • Post-translational
    modifications
    Found both in glycosylated and nonglycosylated forms.
  • Cellular localizationSecreted.
  • Information by UniProt

References for Recombinant human IL17 protein (ab83769)

ab83769 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab83769.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"