Recombinant human IL17A Receptor protein (ab167753)

Overview

Description

  • Nature
    Recombinant
  • Source
    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      LRLLDHRALVCSQPGLNCTVKNSTCLDDSWIHPRNLTPSSPKDLQIQLHF AHTQQGDLFPVAHIEWTLQTDASILYLEGAELSVLQLNTNERLCVRFEFL SKLRHHHRRWRFTFSHFVVDPDQEYEVTVHHLPKPIPDGDPNHQSKNFLV PDCEHARMKVTTPCMSSGSLWDPNITVETLEAHQLRVSFTLWNESTHYQI LLTSFPHMENHSCFEHMHHIPAPRPEEFHQRSNVTLTLRNLKGCCRHQVQ IQPFFSSCLNDCLRHSATVSCPEMPDTPEPIPDYMPLW
    • Molecular weight
      34 kDa including tags
    • Amino acids
      33 to 320
    • Tags
      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab167753 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity
    Measured by its ability to inhibit IL17 induced IL6 secretion by NIH-3T3 mouse embryonic fibroblast cells. The ED50 for this effect is typically 0.01-0.1 µg/mL in the presence of 10 ng/mL recombinant Human IL17.
  • Applications

    SDS-PAGE

    Functional Studies

  • Endotoxin level
    < 1.000 Eu/µg
  • Purity
    > 98 % SDS-PAGE.
    ab167753 is lyophilized from 0.22 µm filtered solution.
  • Form
    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituents: 94% PBS, 5% Trehalose

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    It is recommended to reconstitute the lyophilized protein in sterile deionized water. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage.

General Info

  • Alternative names
    • CANDF5
    • CD217
    • CD217 antigen
    • CDw217
    • CTLA8
    • HIL 17R
    • hIL17R
    • I17RA_HUMAN
    • IL 17 receptor
    • IL 17 receptor A
    • IL 17RA
    • IL-17 receptor A
    • IL-17RA
    • IL17
    • IL17A receptor
    • IL17R
    • IL17RA
    • IMD51
    • Interleukin 17 receptor A
    • Interleukin-17 receptor A
    • MGC10262
    see all
  • Function
    Receptor for IL17A and IL17F. Binds its IL17A ligand with low affinity, suggesting that additional components are involved in IL17A-induced signaling.
  • Tissue specificity
    Widely expressed.
  • Involvement in disease
    Defects in IL17RA are the cause of familial candidiasis type 5 (CANDF5) [MIM:613953]. CANDF5 is a rare disorder with altered immune responses and impaired clearance of fungal infections, selective against Candida. It is characterized by persistent and/or recurrent infections of the skin, nails and mucous membranes caused by organisms of the genus Candida, mainly Candida albicans.
  • Sequence similarities
    Contains 1 SEFIR domain.
  • Post-translational
    modifications
    Glycosylated.
  • Cellular localization
    Membrane.
  • Information by UniProt

Images

  • SDS-PAGE analysis of reduced ab167753 stained overnight with Coomassie Blue.

References

ab167753 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab167753.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up