Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MRKIPKVGHTFFQKPESCPPVPGGSMKLDIGIINENQRVSMSRNIESRST SPWNYTVTWDPNRYPSEVVQAQCRNLGCINAQGKEDISMNSVPIQQETLV VRRKHQGCSVSFQLEKVLVTVGCTCVTPVIHHVQ
    • Molecular weight
      30 kDa
    • Amino acids
      31 to 163
    • Additional sequence information
      A disulfide-linked homodimer consisting of two 133 amino acid polypeptide chains. This product is for the mature full length protein from aa 31 to 163. The signal peptide is not included.

Associated products

Specifications

Our Abpromise guarantee covers the use of ab200270 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity

    Measured by its ability to induce IL-6 production by NHDF cells, it’s fully biologically active when compared to standard.

  • Applications

    SDS-PAGE

    Functional Studies

    HPLC

  • Endotoxin level
    < 1.000 Eu/µg
  • Purity
    >95% by SDS-PAGE .

  • Form
    Lyophilised
  • Additional notes

    This lyophilized preparation is stable for several weeks at 2-8°C, but should be kept at -20°C for long term storage, preferably desiccated.Upon reconstitution, the preparation is stable for up to one week at 2-8°C. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20°C to -70°C. 

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C. Avoid freeze / thaw cycle.

    pH: 7.4
    Constituent: 100% PBS

    Lyophilized from a 0.2 um filtered concentrated solution.

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in 4 mM HCl to a concentration of 0.1 mg/ml. Stock solutions should be apportioned into working aliquots and stored at <-20°C. Further dilutions should be made in appropriate buffered solutions.

General Info

  • Alternative names
    • CANDF6
    • Cytokine ML 1
    • Cytokine ML-1
    • IL 17F
    • IL 24
    • IL-17F
    • Il17f
    • IL17F_HUMAN
    • Interleukin 17F
    • Interleukin 24
    • Interleukin-17F
    • ML 1
    • ML1
    • Mutant IL 17F
    • OTTHUMP00000016602
    see all
  • Function
    Ligand for IL17RA and IL17RC (PubMed:17911633). The heterodimer formed by IL17A and IL17F is a ligand for the heterodimeric complex formed by IL17RA and IL17RC (PubMed:18684971). Involved in stimulating the production of other cytokines such as IL6, IL8 and CSF2, and in regulation of cartilage matrix turnover (PubMed:11591732, PubMed:11591768, PubMed:11574464). Also involved in stimulating the proliferation of peripheral blood mononuclear cells and T-cells and in inhibition of angiogenesis (PubMed:11591732). Plays a role in the induction of neutrophilia in the lungs and in the exacerbation of antigen-induced pulmonary allergic inflammation.
  • Tissue specificity
    Expressed in activated, but not resting, CD4+ T-cells and activated monocytes.
  • Involvement in disease
    Candidiasis, familial, 6
  • Sequence similarities
    Belongs to the IL-17 family.
  • Cellular localization
    Secreted.
  • Information by UniProt

References

ab200270 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab200270.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up