Overview

Description

  • NatureRecombinant
  • SourceHEK 293 cells
  • Amino Acid Sequence
    • SpeciesHuman
    • SequenceRKIPKVGHTFFQKPESCPPVPGGSMKLDIGIINENQRVSMSRNIESRSTS PWNYT VTWDPNRYPSEVVQAQCRNLGCINAQGKEDISMNSVPIQQETL VVRRKHQGCSVS FQLEKVLVTVGCTCVTPVIHHVQ

Specifications

Our Abpromise guarantee covers the use of ab85600 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activityActivity : The activity of IL17F is measured by its ability to induce IL6 production in NHDF cells. The ED50 is typically between 0.04 and 0.1 ng/ml.
  • Applications

    SDS-PAGE

  • Purity> 95 % SDS-PAGE.

  • FormLyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C.

    Preservative: None
    Constituents: 10% Trehalose, 1% Human serum albumin, PBS

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • ReconstitutionReconstitution: It is recommended that 0.5 ml of sterile phosphate-buffered saline be added to the vial. Following reconstitution short-term storage at 4°C and longer-term storage of aliquots at -18 to -20°C is recommended. Repeated freeze thawing is not recommended.

General Info

  • Alternative names
    • CANDF6
    • Cytokine ML 1
    • Cytokine ML-1
    • IL 17F
    • IL 24
    • IL-17F
    • Il17f
    • IL17F_HUMAN
    • Interleukin 17F
    • Interleukin 24
    • Interleukin-17F
    • ML 1
    • ML1
    • Mutant IL 17F
    • OTTHUMP00000016602
    see all
  • FunctionLigand for IL17RA and IL17RC (PubMed:17911633). The heterodimer formed by IL17A and IL17F is a ligand for the heterodimeric complex formed by IL17RA and IL17RC (PubMed:18684971). Involved in stimulating the production of other cytokines such as IL6, IL8 and CSF2, and in regulation of cartilage matrix turnover (PubMed:11591732, PubMed:11591768, PubMed:11574464). Also involved in stimulating the proliferation of peripheral blood mononuclear cells and T-cells and in inhibition of angiogenesis (PubMed:11591732). Plays a role in the induction of neutrophilia in the lungs and in the exacerbation of antigen-induced pulmonary allergic inflammation.
  • Tissue specificityExpressed in activated, but not resting, CD4+ T-cells and activated monocytes.
  • Involvement in diseaseCandidiasis, familial, 6
  • Sequence similaritiesBelongs to the IL-17 family.
  • Cellular localizationSecreted.
  • Information by UniProt

Recombinant human IL17F protein images

  • 1D SDS-PAGE of ab85600 before and after treatment with glycosidases to remove oligosaccharides.
    Lane 1: ab85600
    Lane 2: ab85600 treated with PNGase F to remove potential N-linked glycans
    Lane 3: ab85600 treated with a glycosidase cocktail to remove potential N- and O-linked glycans.
    Approximately 5 µg of protein was loaded per lane; Gel was stained using Coomassie.

    Drop in MW after treatment with PNGase F indicates presence of N-linked glycans. Additional bands in lane 2 and lane 3 are glycosidase enzymes.

References for Recombinant human IL17F protein (ab85600)

ab85600 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab85600.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"