Overview

Description

  • Nature
    Recombinant
  • Source
    HEK 293 cells
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      RKIPKVGHTFFQKPESCPPVPGGSMKLDIGIINENQRVSMSRNIESRSTS PWNYT VTWDPNRYPSEVVQAQCRNLGCINAQGKEDISMNSVPIQQETL VVRRKHQGCSVS FQLEKVLVTVGCTCVTPVIHHVQ

Specifications

Our Abpromise guarantee covers the use of ab85600 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity
    Activity : The activity of IL17F is measured by its ability to induce IL6 production in NHDF cells. The ED50 is typically between 0.04 and 0.1 ng/ml.
  • Applications

    SDS-PAGE

  • Purity
    > 95 % SDS-PAGE.

  • Form
    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C.

    Preservative: None
    Constituents: 10% Trehalose, 1% Human serum albumin, PBS

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    Reconstitution: It is recommended that 0.5 ml of sterile phosphate-buffered saline be added to the vial. Following reconstitution short-term storage at 4°C and longer-term storage of aliquots at -18 to -20°C is recommended. Repeated freeze thawing is not recommended.

General Info

  • Alternative names
    • CANDF6
    • Cytokine ML 1
    • Cytokine ML-1
    • IL 17F
    • IL 24
    • IL-17F
    • Il17f
    • IL17F_HUMAN
    • Interleukin 17F
    • Interleukin 24
    • Interleukin-17F
    • ML 1
    • ML1
    • Mutant IL 17F
    • OTTHUMP00000016602
    see all
  • Function
    Ligand for IL17RA and IL17RC (PubMed:17911633). The heterodimer formed by IL17A and IL17F is a ligand for the heterodimeric complex formed by IL17RA and IL17RC (PubMed:18684971). Involved in stimulating the production of other cytokines such as IL6, IL8 and CSF2, and in regulation of cartilage matrix turnover (PubMed:11591732, PubMed:11591768, PubMed:11574464). Also involved in stimulating the proliferation of peripheral blood mononuclear cells and T-cells and in inhibition of angiogenesis (PubMed:11591732). Plays a role in the induction of neutrophilia in the lungs and in the exacerbation of antigen-induced pulmonary allergic inflammation.
  • Tissue specificity
    Expressed in activated, but not resting, CD4+ T-cells and activated monocytes.
  • Involvement in disease
    Candidiasis, familial, 6
  • Sequence similarities
    Belongs to the IL-17 family.
  • Cellular localization
    Secreted.
  • Information by UniProt

Images

  • 1D SDS-PAGE of ab85600 before and after treatment with glycosidases to remove oligosaccharides.
    Lane 1: ab85600
    Lane 2: ab85600 treated with PNGase F to remove potential N-linked glycans
    Lane 3: ab85600 treated with a glycosidase cocktail to remove potential N- and O-linked glycans.
    Approximately 5 µg of protein was loaded per lane; Gel was stained using Coomassie.

    Drop in MW after treatment with PNGase F indicates presence of N-linked glycans. Additional bands in lane 2 and lane 3 are glycosidase enzymes.

References

ab85600 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab85600.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up