Recombinant Human IL17RC protein (ab164665)

Overview

  • Product name
    Recombinant Human IL17RC protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MPVPWFLLSLALGRSPVVLSLERLVGPQDATHCSPGLSCRLWDSDILCLP GDIVPAPGPVLAPTHLQTELVLRCQKETDCDLCLRVAVHLAVHGHWEEPE DEEKFGGAADSGVEEPRNASLQAQVVLSFQAYPTARCVLLEVQVPAALVQ FGQSVGSVVYDCFEAALGSEVRIWSYTQPRYEKELNHTQQLPALPWLNVS ADGDNVHLVLNVSEEQHFGLSLYWNQVQGPPKPRWHKNLTGPQIITLNHT DLVPCLCIQVWPLEPDSVRTNICPFREDPRAHQNLWQAARLRLLTLQSWL LDAPCSLPAEAALCWRAPGGDPCQPLVPPLSWENVTVDKVLEFPLLKGHP NLCVQVNSSEKLQLQECLWADSLGPLKDDVLLLETRGPQDNRSLCALEPS GCTSLPSKASTRAARLGEYLLQDLQSGQCLQLWDDDLGALWACPMDKYIH KRWALVWLACLLFAAALSLILLLKKDHAKGWLRLLKQDVRSGGEWEQALG GGPPPGSQACASSPLPSPSVFSGSGRQGPRGSAPLLSR
    • Amino acids
      1 to 538
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164665 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • IL 17 receptor C
    • IL 17RC
    • IL 17RL
    • IL17 receptor C
    • IL17F receptor
    • IL17RL
    • Interleukin 17 receptor C
    • Interleukin 17 receptor homolog
    • Interleukin 17 receptor like
    • Interleukin 17 receptor like protein
    see all
  • Relevance
    IL17RC is a single pass transmembrane protein that shares limited similarity with the interleukin 17 receptor. It is widely expressed in non leukocyte tissues and forms a heteromeric receptor for IL17 with IL17RA. At least four different isoforms are known to exist.
  • Cellular localization
    Cell membrane; Single pass type I membrane protein. Note: soluble isoforms may be produced.

Images

  • ab164665 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164665 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164665.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up