Recombinant Human IL1RL2 protein (ab160204)

Overview

  • Product name
    Recombinant Human IL1RL2 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      DGCKDIFMKNEILSASQPFAFNCTFPPITSGEVSVTWYKNSSKIPVSKII QSRIHQDETWILFLPMEWGDSGVYQCVIKGRDSCHRIHVNLTVFEKHWC
    • Amino acids
      20 to 118
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160204 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • IL 1 receptor related protein 2
    • IL 1Rrp2
    • IL 36R
    • IL-1Rrp2
    • IL-36 receptor
    • IL1 receptor related protein 2
    • IL1R rp2
    • IL1R-rp2
    • Il1rl2
    • IL1RRP2
    • IL36R
    • ILRL2_HUMAN
    • Interleukin 1 receptor like 2
    • Interleukin 1 receptor related protein 2
    • Interleukin-1 receptor-like 2
    • Interleukin-1 receptor-related protein 2
    see all
  • Function
    Receptor for interleukin 1 family member 9 (IL1F9). Binding to the agonist leads to the activation of NF-kappa-B.
  • Sequence similarities
    Belongs to the interleukin-1 receptor family.
    Contains 3 Ig-like C2-type (immunoglobulin-like) domains.
    Contains 1 TIR domain.
  • Cellular localization
    Membrane.
  • Information by UniProt

Images

  • ab160204 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160204 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160204.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up