Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • SpeciesHuman
    • SequenceRecombinant Human IL-2 is a 15.5 kDa protein containing 134 amino acid residues including one intrachain disulfide bond: MAPTSSSTKKTQLQLEHLLLDLQMILNGINNYKNPKLTRML TFKFYMPKKATELKHLQCLEEELKPLEEVLNLAQSKNFHLRPRDLISNI NVIVLELKGSETTFMCEYAD ETATIVEFLNRWITFAQSIISTLT.
    • Amino acids1 to 134

Associated products

Specifications

Our Abpromise guarantee covers the use of ab9619 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity

    The ED50 as determined by the dose-dependent stimulation of murine CTLL-2 cells is ≤ 0.1 ng/ml, corresponding to a specific activity of ≥ 1 x 107 units/mg.

  • Applications

    Functional Studies

    SDS-PAGE

  • Endotoxin level< 0.100 Eu/µg
  • FormLyophilised
  • Additional notesThe ED50, determined by the dose-dependent stimulation of murine CTLL-2 cells, is < 0.1 ng/ml, corresponding to a specific activity of > 1 x 107 units/mg.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Information available upon request.

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • ReconstitutionCentrifuge the vial prior to opening. Reconstitute in 100 mM Acetic Acid to a concentration of 0.1-1.0 mg/ml. This solution can then be diluted into other aqueous buffers and stored at 4oC for 1 week or -20oC for future use.

General Info

  • Alternative names
    • Aldesleukin
    • IL 2
    • IL-2
    • IL2
    • IL2_HUMAN
    • Interleukin 2
    • Interleukin-2
    • Involved in regulation of T cell clonal expansion
    • Lymphokine
    • OTTHUMP00000164090
    • POIL2
    • T Cell Growth Factor
    • T-cell growth factor
    • TCGF
    see all
  • FunctionProduced by T-cells in response to antigenic or mitogenic stimulation, this protein is required for T-cell proliferation and other activities crucial to regulation of the immune response. Can stimulate B-cells, monocytes, lymphokine-activated killer cells, natural killer cells, and glioma cells.
  • Involvement in diseaseNote=A chromosomal aberration involving IL2 is found in a form of T-cell acute lymphoblastic leukemia (T-ALL). Translocation t(4;16)(q26;p13) with involves TNFRSF17.
  • Sequence similaritiesBelongs to the IL-2 family.
  • Cellular localizationSecreted.
  • Information by UniProt

References for Recombinant human IL2 protein (ab9619)

ab9619 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab9619.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"