Recombinant human IL2 Receptor alpha protein (Fc Chimera) (ab84071)

Overview

Description

  • NatureRecombinant
  • SourceHEK 293 cells
  • Amino Acid Sequence
    • AccessionP01589
    • SpeciesHuman
    • SequenceTheoretical Sequence: ELCDDDPPEIPHATFKAMAYKEGTMLNCECKRGFRRIKSGSLYMLCTG NSSHSSWDNQCQCTSSATRNTTKQVTPQPEEQKERKTTEMQSPMQPVD QASLPGHCREPPPWENEATERIYHFVVGQMVYYQCVQGYRALHRGPAE SVCKMTHGKTRWTQPQLICTGEMETSQFPGEEKPQASPEGRPESETSC LVTTTDFQIQTEMAATMETSIFTTGIPKVDKKVEPKSCDKTHTCPPCP APELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWY VDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNK ALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYP SDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNV FSCSVMHEALHNHYTQKSLSLSPGK
    • Amino acids22 to 237

Specifications

Our Abpromise guarantee covers the use of ab84071 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity> 95 % SDS-PAGE.

  • FormLyophilised
  • Additional notesab84071 bound to protein A sepharose beads is able to pull down its ligand, IL2.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. After reconstitution store at -20ºC. Avoid freeze / thaw cycles.

    Preservative: None
    Constituents: 10% Trehalose, 1% Human serum albumin

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • ReconstitutionIt is recommended that 0.5 ml of sterile phosphate-buffered saline be added to the vial. Following reconstitution short-term storage at 4°C is recommended, and longer-term storage of aliquots at -18 to -20°C. Repeated freeze thawing is not recommended.

General Info

  • Alternative names
    • Interleukin 2 receptor alpha chain
    • CD25
    • CD25 antigen
    • IDDM10
    • IL 2 receptor alpha subunit
    • IL-2 receptor subunit alpha
    • IL-2-RA
    • IL-2R subunit alpha
    • IL2 RA
    • IL2-RA
    • IL2R
    • IL2R, alpha chain
    • IL2RA
    • IL2RA_HUMAN
    • Interleukin 2 receptor
    • Interleukin 2 receptor alpha
    • Interleukin-2 receptor subunit alpha
    • p55
    • t-cell growth factor receptor
    • TAC
    • TAC antigen
    • TCGFR
    see all
  • FunctionReceptor for interleukin-2.
  • Involvement in diseaseGenetic variations in IL2RA are associated with susceptibility to diabetes mellitus insulin-dependent type 10 (IDDM10) [MIM:601942]. A multifactorial disorder of glucose homeostasis that is characterized by susceptibility to ketoacidosis in the absence of insulin therapy. Clinical fetaures are polydipsia, polyphagia and polyuria which result from hyperglycemia-induced osmotic diuresis and secondary thirst. These derangements result in long-term complications that affect the eyes, kidneys, nerves, and blood vessels.
  • Sequence similaritiesContains 2 Sushi (CCP/SCR) domains.
  • Cellular localizationMembrane.
  • Information by UniProt

Recombinant human IL2 Receptor alpha protein (Fc Chimera) images

  • 1D SDS-PAGE of ab84071 before and after treatment with glycosidases to remove oligosaccharides.
    Lane 1: ab84071
    Lane 2: ab84071 treated with PNGase F to remove potential N-linked glycans
    Lane 3: ab84071 treated with a glycosidase cocktail to remove potential N- and O-linked glycans.
    10 µg protein loaded per lane; Deep Purple™ stained.

    Drop in MW after treatment with PNGase F indicates presence of N-linked glycans. Subsequent tightening of band after treatment with glycosidase cocktail suggests presence of O-linked glycans. Additional bands in lane 2 and lane 3 are glycosidase enzymes.
  • A sample of ab84071 without carrier protein was reduced and alkylated and focused on a 3-10 IPG strip then run on a 4-20% Tris-HCl 2D gel.
    40µg protein loaded per lane; Deep Purple™ stained. Spot train indicates presence of multiple isoforms.
    Spots within the spot train were cut from the gel and identified as IL2 Receptor alpha (Fc Chimera) by protein mass fingerprinting.
  • Densitometry of protein isoforms visualised by 2-DE.
    The densitometry scan demonstrates the purified human cell expressed protein exists in multiple isoforms, which differ according to their level of post-translational modification.
    The triangle indicates the theoretical MW and pI of the protein.

References for Recombinant human IL2 Receptor alpha protein (Fc Chimera) (ab84071)

ab84071 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab84071.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"