Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      LKTLNLGSCVIATNLQEIRNGFSEIRGSVQAKDGNIDIRILRRTESLQDT KPANRCCLLRHLLRLYLDRVFKNYQTPDHYTLRKISSLANSFLTIKKDLR LCHAHMTCHCGEEAMKKYSQILSHFEKLEPQAAVVKALGELDILLQWMEE TE
    • Molecular weight
      17 kDa
    • Amino acids
      25 to 176

Specifications

Our Abpromise guarantee covers the use of ab151931 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    HPLC

    SDS-PAGE

  • Endotoxin level
    < 1.000 Eu/µg
  • Purity
    >95% by SDS-PAGE .
    Purity is greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
  • Form
    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. The lyophilized protein is stable for a few weeks at room temperature. Store at -20°C long term.

    pH: 7.40
    Constituents: 99% Phosphate Buffer, 0.88% Sodium chloride

  • Reconstitution
    Always centrifuge tubes before opening. Do not mix by vortex or pipetting. Dissolve the lyophilized protein in 1X PBS. It is not recommended to reconstitute to a concentration less than 100 µg/ml.
    Reconstituted protein solution can be stored at 4-7°C for 2-7 days. For long term storage aliquot and store at < -20°C.

General Info

  • Alternative names
    • Cytokine Zcyto10
    • Four alpha helix cytokine
    • IL-20
    • IL10D
    • IL20
    • IL20_HUMAN
    • Interleukin 20
    • Interleukin-20
    • MGC96907
    • UNQ852/PRO1801
    • ZCYTO10
    see all
  • Function
    Cytokine that may be involved in epidermal function and psoriasis. Acts through STAT3.
  • Tissue specificity
    Expressed at very low levels in skin, trachea, and other tissues.
  • Sequence similarities
    Belongs to the IL-10 family.
  • Cellular localization
    Secreted.
  • Information by UniProt

References

ab151931 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab151931.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up