Overview

Description

  • Nature
    Recombinant
  • Source
    BTI-TN-5B1-4 cells
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      RAVPGGSSPAWTQCQQLSQKLCTLAWSAHPLVGHMDLREEGDEETTNDVP HIQCGDGCDPQGLRDNSQFCLQRIHQGLIFYEKLLGSDIFTGEPSLLPDS PVGQLHASLLGLSQLLQPEGHHWETQQIPSLSPSQPWQRLLLRFKILRSL QAFVAVAARVFAHGAATLSPIWELKKDVYVVELDWYPDAPGEMVVLTCDT PEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLL LLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDL TFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACPAA EESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQV EVSWEYPDTWSTPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSATVICRK NASISVRAQDRYYSSSWSEWASVPCS
    • Molecular weight
      54 kDa
    • Additional sequence information
      Recombinant Human IL-23 is a heterodimeric protein consisting of the two subunits, p19 (170 amino acids) and p40 (306 amino acids).

Associated products

Specifications

Our Abpromise guarantee covers the use of ab106889 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity
    Biological activity measured by the ability to induce IL-17 secretion by mouse splenocytes.
  • Applications

    SDS-PAGE

    Functional Studies

  • Endotoxin level
    < 0.100 Eu/µg
  • Purity
    > 95 % SDS-PAGE.
    Purity greater than 95% by SDS-PAGE gel and HPLC analyses. Sterile filtered through a 0.2 micron filter.
  • Form
    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. The lyophilized protein is stable for a few weeks at room temperature. Store at -20°C or -80°C. Avoid freeze / thaw cycle. Please see notes section.

    Preservative: None
    Constituents: 1X PBS, pH 7.2

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    Centrifuge the vial prior to opening. Reconstitute in water to a concentration of 0.5-1.0 mg/ml. Do not vortex. This solution can be stored at 2-8°C for up to 1 week. For extended storage, it is recommended to further dilute in a buffer containing a carrier protein (example 0.1% BSA) and store in working aliquots at -20°C to -80°C.

General Info

  • Alternative names
    • IL 23
    • IL 23 A
    • IL 23 subunit alpha
    • IL 23A
    • IL 23p19
    • IL-23 subunit alpha
    • IL-23-A
    • IL-23p19
    • IL12B
    • IL23
    • Il23a
    • IL23A_HUMAN
    • IL23P19
    • interleukin 12B
    • Interleukin 23 alpha subunit p19
    • Interleukin 23 p19 subunit
    • interleukin 23 subunit alpha
    • interleukin 23 subunit p19
    • interleukin six, G CSF related factor
    • Interleukin-23 subunit alpha
    • Interleukin-23 subunit p19
    • JKA3 induced upon T cell activation
    • MGC79388
    • P19
    • SGRF
    see all
  • Function
    Associates with IL12B to form the IL-23 interleukin, an heterodimeric cytokine which functions in innate and adaptive immunity. IL-23 may constitute with IL-17 an acute response to infection in peripheral tissues. IL-23 binds to an heterodimeric receptor complex composed of IL12RB1 and IL23R, activates the Jak-Stat signaling cascade, stimulates memory rather than naive T-cells and promotes production of proinflammatory cytokines. IL-23 induces autoimmune inflammation and thus may be responsible for autoimmune inflammatory diseases and may be important for tumorigenesis.
  • Tissue specificity
    Secreted by activated dendritic and phagocytic cells and keratinocytes. Also expressed by dermal Langerhans cells (at protein level).
  • Sequence similarities
    Belongs to the IL-6 superfamily.
  • Developmental stage
    Expressed by newborns dendritic cells.
  • Cellular localization
    Secreted. Secreted upon association with IL12B.
  • Information by UniProt

References

ab106889 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab106889.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up