Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MNFQQRLQSLWTLARPFCPPLLATASQMQMVVLPCLGFTLLLWSQVSGAQ GQEFHFGPCQVKGVVPQKLWEAFWAVKDTMQAQDNITSARLLQQEVLQNV SDAESCYLVHTLLEFYLKTVFKNYHNRTVEVRTLKSFSTLANNFVLIVSQ LQPSQENEMFSIRDSAHRRFLLFRRAFKQLDVEAALTKALGEVDILLTWM QKFYKL
    • Amino acids
      1 to 206
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153150 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • C49A
    • FISP
    • IL 24
    • IL 4 induced secreted protein
    • IL-24
    • IL10B
    • Il24
    • IL24_HUMAN
    • interleukin 24
    • Interleukin-24
    • MDA-7
    • MDA7
    • Melanocyte associated Mda 7
    • Melanoma differentiation association protein 7
    • Melanoma differentiation-associated gene 7 protein
    • Mob5
    • ST16
    • Suppression of tumorigenicity 16
    • Suppression of tumorigenicity 16 (melanoma differentiation)
    • Suppression of tumorigenicity 16 protein
    see all
  • Function
    Has antiproliferative properties on melanoma cells and may contribute to terminal cell differentiation.
  • Tissue specificity
    Up-regulated in melanoma cells induced to terminally differentiate.
  • Sequence similarities
    Belongs to the IL-10 family.
  • Cellular localization
    Secreted.
  • Information by UniProt

Images

  • ab153150 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab153150 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153150.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up