Recombinant Human IL28 Receptor alpha protein (ab165762)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      QDVTYFVAYQSSPTRRRWREVEECAGTKELLCSMMCLKKQDLYNKFKGRV RTVSPSSKSPWVESEYLDYLFEVEPAPPVLVLTQTEEILSANATYQLPPC
    • Amino acids
      51 to 150
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab165762 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Class II cytokine receptor CRF2/12
    • CRF2-12
    • CRF2/12
    • Cytokine receptor class-II member 12
    • Cytokine receptor family 2 member 12
    • IFN lambda R1
    • IFN-lambda receptor 1
    • IFNLR
    • IFNLR1
    • IL-28 receptor subunit alpha
    • il-28r1
    • IL28R alpha
    • IL28RA
    • Interferon lambda receptor
    • Interferon lambda receptor 1
    • interleukin 28 alpha receptor
    • interleukin 28 receptor A
    • Interleukin 28 receptor alpha chain
    • Interleukin 28 receptor, alpha
    • interleukin 28 receptor, alpha (interferon, lambda receptor)
    • interleukin or cytokine receptor 2
    • Interleukin-28 receptor subunit alpha
    • LICR2
    • Likely interleukin or cytokine receptor 2
    see all
  • Relevance
    IL28RA is a class II cytokine receptor that interacts with IL10RB to bind IL28A, IL28B, and IL29, which are related to type I interferons. These ligands play a critical role in response to microbial challenge and activate the JAK/STAT signaling system. It heterodimers with IL10RB. There are 4 isoforms as result of alternative splicing. It is widely expressed. IL28RA belongs to the type II cytokine receptor family, and contains 1 fibronectin type III domain.
  • Cellular localization
    Membrane; Single-pass type I membrane protein

Images

  • ab165762 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab165762 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab165762.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up