Overview

Description

  • Nature
    Recombinant
  • Source
    HEK 293 cells
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      Theoretical Sequence: APMTQTTSLKTSWVNCSNMIDEIITHLKQPPLPLLDFNNLNGEDQDILME NNLRRPN LEAFNRAVKSLQNASAIESILKNLLPCLPLATAAPTRHPIH IKDGDWNEFRRKLTFYL KTLENAQAQQTTLSLAIF

Specifications

Our Abpromise guarantee covers the use of ab83685 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity
    Activity: The ED50 of ab83685 is typically 0.1- 0.4 ng/ml as measured using the human growth factor dependent TF1 cell line.
  • Applications

    SDS-PAGE

    Functional Studies

  • Purity
    > 95 % SDS-PAGE.

  • Form
    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C.

    Preservative: None
    Constituents: 10% Trehalose, 1% Human serum albumin, PBS

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    It is recommended that 0.5 ml of sterile phosphate-buffered saline be added to the vial. Short-term storage at 4°C is recommended, and longer-term storage of aliquots at -18 to -20°C. Repeated freeze thawing is not recommended.

General Info

  • Alternative names
    • Colony stimulating factor multiple
    • Hematopoietic growth factor
    • IL 3
    • IL-3
    • IL3
    • IL3_HUMAN
    • Interleukin 3
    • Interleukin 3 (colony stimulating factor, multiple)
    • Interleukin-3
    • Mast cell growth factor
    • MCGF
    • MGC79398
    • MGC79399
    • Multi CSF
    • Multilineage colony stimulating factor
    • Multipotential colony stimulating factor
    • Multipotential colony-stimulating factor
    • OTTHUMP00000065963
    • P cell stimulating factor
    • P-cell-stimulating factor
    see all
  • Function
    Granulocyte/macrophage colony-stimulating factors are cytokines that act in hematopoiesis by controlling the production, differentiation, and function of 2 related white cell populations of the blood, the granulocytes and the monocytes-macrophages.
    This CSF induces granulocytes, macrophages, mast cells, stem cells, erythroid cells, eosinophils and megakaryocytes.
  • Tissue specificity
    Activated T-cells, mast cells, natural killer cells.
  • Sequence similarities
    Belongs to the IL-3 family.
  • Cellular localization
    Secreted.
  • Information by UniProt

Images

  • Densitometry of protein isoforms visualised by 2-DE. The triangle indicates the theoretical MW and pI of the protein.
  • 1D gel data:
    Lane 1 ab83685
    Lane 2 ab83685 treated with PNGase F to remove potential N-linked glycans
    Lane 4 ab83685 treated with a glycosidase cocktail to remove potential N- and O-linked glycans.
    5 µg protein loaded per lane; Deep Purple™ stained. Drop in MW after treatment with PNGase F indicates presence of N-linked glycans. Faint bands in lane 2 and lane 3 are glycosidase enzymes.
  • 2D gel data:
    A sample of ab83685 without carrier protein was reduced and alkylated and focused on a 3-10 IPG strip then run on a 4-20% Tris-HCl 2D gel. 40 µg protein loaded per lane; Deep Purple™ stained.
    Spot train indicates presence of multiple isoforms of ab83685.
    Spots within the spot train were cut from the gel and identified as IL-3 by protein mass fingerprinting.

References

ab83685 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab83685.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up