Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionQ6EBC2
    • SpeciesHuman
    • SequenceSHTLPVRLLRPSDDVQKIVEELQSLSKMLLKDVEEEKGVLVSQNYTLPCL SPDAQPPNNIHSPAI-RAYLKTIRQLDNKSVIDEIIEHLDKLIFQDAPET NISVPTDTHECKRFILTISQQFSECMDLALKSLTSGAQQATT
    • Molecular weight16 kDa including tags
    • Amino acids24 to 164

Specifications

Our Abpromise guarantee covers the use of ab119738 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Purity> 95 % SDS-PAGE.
    Purity by SDS_PAGE and SEC-HPLC: > 95%
  • FormLyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C. Store under Desiccating conditions.

    pH: 7.40
    Constituents: 0.28% Phosphate Buffer, 0.88% Sodium chloride

  • ReconstitutionReconstitute in sterile H2O to a concentration >= 100 µg/ml. This solution can then be diluted into other aqueous buffers. Avoid freeze/thaw cycles.

General Info

  • Alternative names
    • IL 31
    • IL-31
    • IL31
    • IL31_HUMAN
    • Interleukin 31
    • Interleukin-31
    see all
  • FunctionActivates STAT3 and possibly STAT1 and STAT5 through the IL31 heterodimeric receptor composed of IL31RA and OSMR. IL31 may function in skin immunity.
  • Tissue specificityDetected at low levels in testis, bone marrow, skeletal muscle, kidney, colon, thymus, small intestine and trachea.
  • Cellular localizationSecreted.
  • Information by UniProt

References for Recombinant Human IL31 protein (ab119738)

ab119738 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab119738.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"