Recombinant Human IL36 alpha protein (ab153289)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MEKALKIDTPQQGSIQDINHRVWVLQDQTLIAVPRKDRMSPVTIALISCR HVETLEKDRGNPIYLGLNGLNLCLMCAKVGDQPTLQLKEKDIMDLYNQPE PVKSFLFYHSQSGRNSTFESVAFPGWFIAVSSEGGCPLILTQELGKANTT DFGLTMLF
    • Amino acids
      1 to 158
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153289 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • FIL1
    • FIL1 epsilon
    • FIL1(EPSILON)
    • FIL1E
    • IL 1 epsilon
    • IL 1F6
    • IL 1H1
    • IL-1 epsilon
    • IL-1F6
    • IL1E
    • IL1F6
    • IL1F6_HUMAN
    • IL1RP2
    • IL36A
    • Interleukin 1 epsilon
    • Interleukin 1 family member 6
    • Interleukin 1 family member 6 (epsilon)
    • Interleukin 36 alpha
    • Interleukin-1 epsilon
    • Interleukin-1 family member 6
    • MGC129552
    • MGC129553
    • MGC151479
    • MGC151481
    • OTTMUSP00000012798
    • RP23-176J12.4
    see all
  • Tissue specificity
    Expressed in immune system and fetal brain, but not in other tissues tested or in multiple hematopoietic cell lines.
  • Sequence similarities
    Belongs to the IL-1 family.
  • Cellular localization
    Secreted.
  • Information by UniProt

Images

  • ab153289 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab153289 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153289.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up