Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      TKEDPNPPITNLRMKAKAQQLTWDLNRNVTDIECVKDADYSMPAVNNSYC QFGAISLCEVTNYTVRVANPPFSTWILFPENSGKPWAGAEN
    • Amino acids
      19 to 109
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158757 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CD123
    • CD123 antigen
    • hIL 3Ra
    • hIL-3Ra
    • hIL3Ra
    • IL 3 receptor alpha SP2 isoform
    • IL 3R alpha
    • IL-3 receptor subunit alpha
    • IL-3R subunit alpha
    • IL-3R-alpha
    • IL-3RA
    • IL3 Receptor alpha
    • IL3R
    • Il3ra
    • IL3RA_HUMAN
    • IL3RAX
    • IL3RAY
    • IL3RX
    • IL3RY
    • Interleukin 3 receptor alpha chain
    • Interleukin 3 receptor, alpha
    • Interleukin 3 receptor, alpha (low affinity)
    • Interleukin-3 Receptor alpha
    • Interleukin-3 receptor subunit alpha
    • Interleukin3 receptor
    • Interleukin3 receptor, Y-chromosomal
    see all
  • Function
    This is a receptor for interleukin-3.
  • Sequence similarities
    Belongs to the type I cytokine receptor family. Type 5 subfamily.
  • Domain
    The WSXWS motif appears to be necessary for proper protein folding and thereby efficient intracellular transport and cell-surface receptor binding.
    The box 1 motif is required for JAK interaction and/or activation.
  • Cellular localization
    Membrane.
  • Information by UniProt

Images

  • ab158757 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158757 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158757.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up