Recombinant Human IL3RA protein (Fc Chimera) (ab88358)

Overview

Description

  • Nature
    Recombinant
  • Source
    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      TKEDPNPPITNLRMKAKAQQLTWDLNRNVTDIECVKDADYSMPAVN NS YCQFGAISLCEVTNYTVRVANPPFSTWILFPENSGKPWAGAENL TCWI HDVDFLSCSWAVGPGAPADVQYDLYLNVANRRQQYECLHYKT DAQGTR IGCRFDDISRLSSGSQSSHILVRGRSAAFGIPCTDKFVVF SQIEILTP PNMTAKCNKTHSFMHWKMRSHFNRKFRYELQIQKRMQP VITEQVRDRT SFQLLNPGTYTVQIRARERVYEFLSAWSTPQRFECD QEEGANTRGGRV DGIQWIPKVDKKVEPKSCDKTHTCPPCPAPELLG GPSVFLFPPKPKDT LMISRTPEVTCVVVDVSHEDPEVKFNWYVDGV EVHNAKTKPREEQYNS TYRVVSVLTVLHQDWLNGKEYKCRVSNKAL PAPIEKTISKAKGQPREP QVYTLPPSRDELTKNQVSLTCLVKGFYP SDIAVEWESNGQPENNYKTT PPVLDSDGSFFLYSKLTVDKSRWQQG NVFSCSVMHEALHNHYTQKSLS LSPGK
    • Amino acids
      19 to 302
    • Additional sequence information
      DNA sequence encoding the signal peptide and extracellular domain of human IL3R alpha (aa 1-18) was fused to the Fc region of human IgG1 (aa 93-330). Protein expressed in modified human 293 cells.

Specifications

Our Abpromise guarantee covers the use of ab88358 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Functional Studies

    SDS-PAGE

  • Purity
    > 95 % SDS-PAGE.

  • Form
    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. After reconstitution store at -20ºC. Avoid freeze / thaw cycles.

    Preservative: None
    Constituents: 10% Trehalose, 1% Human serum albumin

  • Reconstitution
    It is recommended that 0.5 ml of sterile phosphate-buffered saline be added to the vial. Following reconstitution short-term storage at 4°C is recommended, and longer-term storage of aliquots at -18 to -20°C. Repeated freeze thawing is not recommended.

General Info

  • Alternative names
    • CD123
    • CD123 antigen
    • hIL 3Ra
    • hIL-3Ra
    • hIL3Ra
    • IL 3 receptor alpha SP2 isoform
    • IL 3R alpha
    • IL-3 receptor subunit alpha
    • IL-3R subunit alpha
    • IL-3R-alpha
    • IL-3RA
    • IL3 Receptor alpha
    • IL3R
    • Il3ra
    • IL3RA_HUMAN
    • IL3RAX
    • IL3RAY
    • IL3RX
    • IL3RY
    • Interleukin 3 receptor alpha chain
    • Interleukin 3 receptor, alpha
    • Interleukin 3 receptor, alpha (low affinity)
    • Interleukin-3 Receptor alpha
    • Interleukin-3 receptor subunit alpha
    • Interleukin3 receptor
    • Interleukin3 receptor, Y-chromosomal
    see all
  • Function
    This is a receptor for interleukin-3.
  • Sequence similarities
    Belongs to the type I cytokine receptor family. Type 5 subfamily.
  • Domain
    The WSXWS motif appears to be necessary for proper protein folding and thereby efficient intracellular transport and cell-surface receptor binding.
    The box 1 motif is required for JAK interaction and/or activation.
  • Cellular localization
    Membrane.
  • Information by UniProt

Images

  • 1D SDS-PAGE of ab88358 before and after treatment with glycosidases to remove oligosaccharides.
    Lane 1: ab88358
    Lane 2: ab88358 treated with PNGase F to remove potential N-linked glycans
    Lane 3: ab88358 treated with a glycosidase cocktail to remove potential N- and O-linked glycans.

    Drop in MWt after treatment with PNGase F indicates presence of N-linked glycans. Subsequent drop in MWt after treatment with glycosidase cocktail indicates presence of O-linked glycans. Faint bands in lane 2 and lane 3 are glycosidase enzymes.
  • A sample of ab88358 without carrier protein was reduced and alkylated and focused on a 3-10 IPG strip then run on a 4-20% Tris-HCl 2D gel. Spot train indicates presence of multiple isoforms of ab88358.
  • Densitometry of protein isoforms visualised by 2-DE.
    The densitometry scan demonstrates the purified human cell expressed protein exists in multiple isoforms, which differ according to their level of post-translational modification.
    The triangle indicates the theoretical MWt and pI of the protein.

References

ab88358 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab88358.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up