Recombinant Human IL3RA protein (Fc Chimera) (ab88358)

Overview

Description

  • NatureRecombinant
  • SourceHEK 293 cells
  • Amino Acid Sequence
    • AccessionP26951
    • SpeciesHuman
    • SequenceTKEDPNPPITNLRMKAKAQQLTWDLNRNVTDIECVKDADYSMPAVN NS YCQFGAISLCEVTNYTVRVANPPFSTWILFPENSGKPWAGAENL TCWI HDVDFLSCSWAVGPGAPADVQYDLYLNVANRRQQYECLHYKT DAQGTR IGCRFDDISRLSSGSQSSHILVRGRSAAFGIPCTDKFVVF SQIEILTP PNMTAKCNKTHSFMHWKMRSHFNRKFRYELQIQKRMQP VITEQVRDRT SFQLLNPGTYTVQIRARERVYEFLSAWSTPQRFECD QEEGANTRGGRV DGIQWIPKVDKKVEPKSCDKTHTCPPCPAPELLG GPSVFLFPPKPKDT LMISRTPEVTCVVVDVSHEDPEVKFNWYVDGV EVHNAKTKPREEQYNS TYRVVSVLTVLHQDWLNGKEYKCRVSNKAL PAPIEKTISKAKGQPREP QVYTLPPSRDELTKNQVSLTCLVKGFYP SDIAVEWESNGQPENNYKTT PPVLDSDGSFFLYSKLTVDKSRWQQG NVFSCSVMHEALHNHYTQKSLS LSPGK
    • Amino acids19 to 302
    • Additional sequence informationDNA sequence encoding the signal peptide and extracellular domain of human IL3R alpha (aa 1-18) was fused to the Fc region of human IgG1 (aa 93-330). Protein expressed in modified human 293 cells.

Specifications

Our Abpromise guarantee covers the use of ab88358 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Functional Studies

    SDS-PAGE

  • Purity> 95 % SDS-PAGE.

  • FormLyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. After reconstitution store at -20ºC. Avoid freeze / thaw cycles.

    Preservative: None
    Constituents: 10% Trehalose, 1% Human serum albumin

  • ReconstitutionIt is recommended that 0.5 ml of sterile phosphate-buffered saline be added to the vial. Following reconstitution short-term storage at 4°C is recommended, and longer-term storage of aliquots at -18 to -20°C. Repeated freeze thawing is not recommended.

General Info

  • Alternative names
    • CD123
    • CD123 antigen
    • hIL 3Ra
    • hIL-3Ra
    • hIL3Ra
    • IL 3 receptor alpha SP2 isoform
    • IL 3R alpha
    • IL-3 receptor subunit alpha
    • IL-3R subunit alpha
    • IL-3R-alpha
    • IL-3RA
    • IL3 Receptor alpha
    • IL3R
    • Il3ra
    • IL3RA_HUMAN
    • IL3RAX
    • IL3RAY
    • IL3RX
    • IL3RY
    • Interleukin 3 receptor alpha chain
    • Interleukin 3 receptor, alpha
    • Interleukin 3 receptor, alpha (low affinity)
    • Interleukin-3 Receptor alpha
    • Interleukin-3 receptor subunit alpha
    • Interleukin3 receptor
    • Interleukin3 receptor, Y-chromosomal
    see all
  • FunctionThis is a receptor for interleukin-3.
  • Sequence similaritiesBelongs to the type I cytokine receptor family. Type 5 subfamily.
  • DomainThe WSXWS motif appears to be necessary for proper protein folding and thereby efficient intracellular transport and cell-surface receptor binding.
    The box 1 motif is required for JAK interaction and/or activation.
  • Cellular localizationMembrane.
  • Information by UniProt

Recombinant Human IL3RA protein (Fc Chimera) images

  • 1D SDS-PAGE of ab88358 before and after treatment with glycosidases to remove oligosaccharides.
    Lane 1: ab88358
    Lane 2: ab88358 treated with PNGase F to remove potential N-linked glycans
    Lane 3: ab88358 treated with a glycosidase cocktail to remove potential N- and O-linked glycans.

    Drop in MWt after treatment with PNGase F indicates presence of N-linked glycans. Subsequent drop in MWt after treatment with glycosidase cocktail indicates presence of O-linked glycans. Faint bands in lane 2 and lane 3 are glycosidase enzymes.
  • A sample of ab88358 without carrier protein was reduced and alkylated and focused on a 3-10 IPG strip then run on a 4-20% Tris-HCl 2D gel. Spot train indicates presence of multiple isoforms of ab88358.
  • Densitometry of protein isoforms visualised by 2-DE.
    The densitometry scan demonstrates the purified human cell expressed protein exists in multiple isoforms, which differ according to their level of post-translational modification.
    The triangle indicates the theoretical MWt and pI of the protein.

References for Recombinant Human IL3RA protein (Fc Chimera) (ab88358)

ab88358 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab88358.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"