Recombinant Human IL3RB protein (Fc Chimera) (ab83919)

Overview

Description

  • Nature
    Recombinant
  • Source
    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      Theoretical Sequence: WERSLAGAEETIPLQTLRCYNDYTSHITCRWADTQDAQRLVNVTLIRRVN EDLLEPVSCDLSDDMPWSACPHPRCVPRRCVIPCQSFVVTDVDYFSFQPD RPLGTRLTVTLTQHVQPPEPRDLQISTDQDHFLLTWSVALGSPQSHWLSP GDLEFEVVYKRLQDSWEDAAILLSNTSQATLGPEHLMPSSTYVARVRTRL APGSRLSGRPSKWSPEVCWDSQPGDEAQPQNLECFFDGAAVLSCSWEVRK EVASSVSFGLFYKPSPDAGEEECSPVLREGLGSLHTRHHCQIPVPDPATH GQYIVSVQPRRAEKHIKSSVNIQMAPPSLNVTKDGDSYSLRWETMKMRYE HIDHTFEIQYRKDTATWKDSKTETLQNAHSMALPALEPSTRYWARVRVRT SRTGYNGIWSEWSEARSWDTESVLPMWGSSNTKVDKKVEPKSCDKTHTCP PCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNW YVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKA LPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDI AVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSV MHEALHNHYTQKSLSLSPGK
    • Amino acids
      1 to 443
    • Additional sequence information
      Fused with the Fc region of Human IgG1 at the C-terminus.

Specifications

Our Abpromise guarantee covers the use of ab83919 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity
    > 95 % SDS-PAGE.

  • Form
    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. After reconstitution store at -20ºC. Avoid freeze / thaw cycles.

    Preservative: None
    Constituents: 10% Trehalose, 1% Human serum albumin, PBS

  • Reconstitution
    It is recommended that 0.5 ml of sterile phosphate-buffered saline be added to the vial. Following reconstitution short-term storage at 4°C is recommended, with longer-term storage in aliquots at -18 to -20°C. Repeated freeze thawing is not recommended.

General Info

  • Alternative names
    • /granulocyte-macrophage colony-stimulating factor receptor, beta
    • Beta-C
    • CD131
    • CDw131
    • Colony stimulating factor 2 receptor beta
    • Colony stimulating factor 2 receptor beta low affinity (granulocyte macrophage)
    • Common beta chain
    • Csf2rb
    • Cytokine receptor common beta chain
    • Cytokine receptor common beta chain precursor (CDw131 antigen)
    • Cytokine receptor common subunit beta
    • GM CSF/IL 3/IL 5 receptor common beta chain
    • GM-CSF/IL-3/IL-5 receptor common beta subunit
    • IL3RB
    • IL3RB_HUMAN
    • IL5RB
    • Interleukin 3 receptor, beta
    • Interleukin 3 receptor/granulocyte macrophage colony stimulating factor 3 receptor beta (high affinity)
    • Interleukin 5 receptor, beta
    • SMDP5
    • stimulating factor 3 receptor, beta (high affinity)
    see all
  • Function
    High affinity receptor for interleukin-3, interleukin-5 and granulocyte-macrophage colony-stimulating factor.
  • Sequence similarities
    Belongs to the type I cytokine receptor family. Type 4 subfamily.
    Contains 2 fibronectin type-III domains.
  • Domain
    The WSXWS motif appears to be necessary for proper protein folding and thereby efficient intracellular transport and cell-surface receptor binding.
    The box 1 motif is required for JAK interaction and/or activation.
  • Cellular localization
    Membrane.
  • Information by UniProt

Images

  • Densitometry of protein isoforms visualised by 2-DE.
    The densitometry scan demonstrates the purified Human cell expressed protein exists in multiple isoforms, which differ according to their level of post-translational modification.
    The triangle indicates the theoretical MW and pI of the protein.
  • 1D SDS-PAGE of ab83919 before and after treatment with glycosidases to remove oligosaccharides.
    Lane 1: ab83919
    Lane 2: ab83919 treated with PNGase F to remove potential N-linked glycans
    Lane 3: ab83919 treated with a glycosidase cocktail to remove potential N- and O-linked glycans.
    Approximately 5 μg of protein was loaded per lane; Gel was stained using Deep Purple™.

References

ab83919 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab83919.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up