Overview

Description

  • Nature
    Recombinant
  • Source
    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MKVLQEPTCVSDYMSISTCEWKMNGPTNCSTELRLLYQLVFLLSEAHTCI PENNGGAGCVCHLLMDDVVSADNYTLDLWAGQQLLWKGSFKPSEHVKPRA PGNLTVHTNVSDTLLLTWSNPYPPDNYLYNHLTYAVNIWSENDPADFRIY NVTYLEPSLRIAASTLKSGISYRARVRAWAQCYNTTWSEWSPSTKWHNSY REPFEQH
    • Molecular weight
      25 kDa including tags
    • Amino acids
      26 to 232
    • Tags
      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab167726 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity
    Measured by its ability to inhibit IL4-dependent proliferation of TF1 Human erythroleukemic cells. Approximately 253 ng/mL of ab167726 will inhibit 50% of the biological response due to 0.2 ng/mL of rhIL4.
  • Applications

    Functional Studies

    SDS-PAGE

  • Endotoxin level
    < 1.000 Eu/µg
  • Purity
    >95% by SDS-PAGE .

  • Form
    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituent: 99% PBS
    Note: Normally Mannitol or Trehalose are added as protectants before lyophilization.

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    It is recommended to reconstitute the lyophilized protein in 50µl sterile deionized water to a final concentration of 1mg/ml. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage.

General Info

  • Alternative names
    • CD124
    • IL 4R alpha
    • IL-4 receptor subunit alpha
    • IL-4-binding protein
    • IL-4R subunit alpha
    • IL-4R-alpha
    • IL-4RA
    • IL4-BP
    • Il4r
    • IL4R nirs variant 1
    • IL4RA
    • IL4RA_HUMAN
    • Interleukin 4 receptor
    • Interleukin 4 receptor alpha chain
    • sIL4Ralpha/prot
    • Soluble IL-4 receptor subunit alpha
    • Soluble IL-4R-alpha
    • Soluble interleukin-4 receptor subunit alpha
    see all
  • Function
    Receptor for both interleukin 4 and interleukin 13. Couples to the JAK1/2/3-STAT6 pathway. The IL4 response is involved in promoting Th2 differentiation. The IL4/IL13 responses are involved in regulating IgE production and, chemokine and mucus production at sites of allergic inflammmation. In certain cell types, can signal through activation of insulin receptor substrates, IRS1/IRS2.
    Soluble IL4R (sIL4R) inhibits IL4-mediated cell proliferation and IL5 up-regulation by T-cells.
  • Tissue specificity
    Isoform 1 and isoform 2 are highly expressed in activated T-cells.
  • Sequence similarities
    Belongs to the type I cytokine receptor family. Type 4 subfamily.
    Contains 1 fibronectin type-III domain.
  • Domain
    The extracellular domain represents the IL4 binding protein (IL4BP).
    The WSXWS motif appears to be necessary for proper protein folding and thereby efficient intracellular transport and cell-surface receptor binding.
    The box 1 motif is required for JAK interaction and/or activation.
    Contains 1 copy of a cytoplasmic motif that is referred to as the immunoreceptor tyrosine-based inhibitor motif (ITIM). This motif is involved in modulation of cellular responses. The phosphorylated ITIM motif can bind the SH2 domain of several SH2-containing phosphatases.
  • Post-translational
    modifications
    On IL4 binding, phosphorylated on C-terminal tyrosine residues. Phosphorylation on any one of tyrosine residues, Tyr-575, Tyr-603 or Tyr-631, is required for STAT6-induced gene induction.
    The soluble form (sIL4R/IL4BP) can also be produced by proteolytic cleavage at the cell surface (shedding) by a metalloproteinase.
  • Cellular localization
    Secreted and Cell membrane.
  • Information by UniProt

Images

  • SDS-PAGE of reduced ab167726 stained overnight with Coomassie Blue.

References

ab167726 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab167726.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up