Overview

Description

  • Nature
    Recombinant
  • Source
    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      IPTEIPTSALVKETLALLSTHRTLLIANETLRIPVPVHKNHQLCTEEIFQ GIGTLESQTVQGGTVERLFKNLSLIKKYIDGQKKKCGEERRRVNQFLDYL QEFLGVMNTEWIIESVDHHHHHH
    • Molecular weight
      14 kDa including tags
    • Amino acids
      20 to 134
    • Tags
      His tag C-Terminus
    • Additional sequence information
      This product is the mature full length protein from aa 20 to 134. The signal peptide is not included.

Specifications

Our Abpromise guarantee covers the use of ab194157 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Endotoxin level
    < 1.000 Eu/ng
  • Purity
    >95% by SDS-PAGE .
    Purity greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
  • Form
    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. The lyophilized protein is stable for a few weeks at room temperature. Store at -20°C long term. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituent: 100% PBS

    Lyophilized from a 0.2 µM filtered solution.

  • Reconstitution
    Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.

General Info

  • Alternative names
    • B-cell differentiation factor I
    • Colony stimulating factor
    • EDF
    • Eosinophil differentiation factor
    • IL-5
    • IL5
    • IL5_HUMAN
    • Interleukin 5
    • Interleukin 5 (colony stimulating factor, eosinophil)
    • Interleukin-5
    • T Cell Replacing Factor
    • T-cell replacing factor
    • TRF
    see all
  • Function
    Factor that induces terminal differentiation of late-developing B-cells to immunoglobulin secreting cells.
  • Sequence similarities
    Belongs to the IL-5 family.
  • Cellular localization
    Secreted.
  • Information by UniProt

References

ab194157 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab194157.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up