Overview

Description

  • Nature
    Recombinant
  • Source
    HEK 293 cells
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      Theoretical sequence: IPTEIPTSALVKETLALLSTHRTLLIANETLRIPVPVHK NHQLCTEEIF QGIGTLESQTVQGGTVERLFKNLSLIKKYIDGQKKKCG EERRRVNQFLD YLQEFLGVMNTEWIIES

Specifications

Our Abpromise guarantee covers the use of ab83941 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity
    > 95 % SDS-PAGE.

  • Form
    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C.

    Preservative: None
    Constituents: 10% Trehalose, 1% Human serum albumin

  • Reconstitution
    It is recommended that 0.5 ml of sterile phosphate-buffered saline be added to the vial. Following reconstitution short-term storage at 4°C is recommended, and longer-term storage of aliquots at -18 to -20°C. Repeated freeze thawing is not recommended.

General Info

  • Alternative names
    • B-cell differentiation factor I
    • Colony stimulating factor
    • EDF
    • Eosinophil differentiation factor
    • IL-5
    • IL5
    • IL5_HUMAN
    • Interleukin 5
    • Interleukin 5 (colony stimulating factor, eosinophil)
    • Interleukin-5
    • T Cell Replacing Factor
    • T-cell replacing factor
    • TRF
    see all
  • Function
    Factor that induces terminal differentiation of late-developing B-cells to immunoglobulin secreting cells.
  • Sequence similarities
    Belongs to the IL-5 family.
  • Cellular localization
    Secreted.
  • Information by UniProt

Images

  • Lane 1 – MW markers; Lane 2 – ab83941; Lane 3 – ab83941 treated with PNGase F to remove potential N-linked glycans; Lane 4 – ab83941 treated with a glycosidase cocktail to remove potential N- and O-linked glycans. 10 ug protein loaded per lane. Deep Purple stained.
    Appearance of two bands after treatment with PNGase F indicates presence of N-linked glycans. Subsequent drop in MW of top band after treatment with glycosidase cocktail indicates presence of O-linked glycans.

    Additional bands in lane 3 and lane 4 are glycosidase enzymes.
  • Post-translational modifications result in protein heterogeneity. The densitometry scan demonstrates the purified human cell expressed protein exists in multiple isoforms, which differ according to their level of post-translational modification.
    The triangle indicates theoretical pI and MW of theprotein.

References

ab83941 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab83941.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up