Recombinant Human IL5RA protein (Fc Chimera) (ab83828)

Overview

  • Product nameRecombinant Human IL5RA protein (Fc Chimera)
  • Protein lengthProtein fragment

Description

  • NatureRecombinant
  • SourceHEK 293 cells
  • Amino Acid Sequence
    • AccessionQ01344
    • SpeciesHuman
    • SequenceDLLPDEKISLLPPVNFTIKVTGLAQVLLQWKPNPDQEQRNVNLEYQVKIN APKEDDYETRITESKCVTILHKGFSASVRTILQNDHSLLASSWASAELHA PPGSPGTSIVNLTCTTNTTEDNYSRLRSYQVSLHCTWLVGTDAPEDTQYF LYYRYGSWTEECQEYSKDTLGRNIACWFPRTFILSKGRDWLAVLVNGSSK HSAIRPFDQLFALHAIDQINPPLNVTAEIEGTRLSIQWEKPVSAFPIHCF DYEVKIHNTRNGYLQIEKLMTNAFISIIDDLSKYDVQVRAAVSSMCREAG LW
    • Molecular weight62 kDa including tags
    • Amino acids21 to 322
    • Additional sequence informationChimeric Protein: A DNA sequence (aa 21-322) was fused to the Fc region of human IgG1 (aa 93-330).

Associated products

Specifications

Our Abpromise guarantee covers the use of ab83828 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity>95% by SDS-PAGE .

  • FormLyophilised
  • Additional notes

    Molecular mass: Chimera migrates as a broad band between 70 and 80 kDa in SDS-PAGE due to post-translation modifications, in particular glycosylation. This compares

    with the unmodified Chimera that has a predicted molecular mass of 62.1 kDa. The final cellular processed form of the protein is expected to be 301 amino acids in length.

    pI: Chimera separates into a number of isoforms with a pI between 5.8 and 7.0 in 2D PAGE due to post-translational modifications, in particular glycosylation. This compares with the unmodified Chimera that has a predicted pI of 6.34.

    Chimera consists of 10-25% carbohydrate by weight.

    Chimera has N-linked and O-linked oligosaccharides.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. Reconstitute for long term storage.

    Constituents: 89% PBS, 10% Trehalose, 1% Human serum albumin

  • ReconstitutionIt is recommended that 0.5 ml of sterile phosphate-buffered saline be added to the vial. Following reconstitution short-term storage at 4°C is recommended, and longer-term storage of aliquots at -18 to -20°C. Repeated freeze thawing is not recommended.

General Info

  • Alternative names
    • CD125
    • CD125 antigen
    • CDw125
    • HSIL5R3
    • IL-5 receptor subunit alpha
    • IL-5R subunit alpha
    • IL-5R-alpha
    • IL-5RA
    • IL5R
    • IL5RA
    • IL5RA_HUMAN
    • Interleukin 5 Receptor alpha
    • Interleukin 5 Receptor alpha chain
    • Interleukin 5 receptor alpha subunit
    • Interleukin 5 receptor subunit alpha
    • Interleukin 5 receptor type 3
    • Interleukin-5 receptor subunit alpha
    • MGC26560
    see all
  • FunctionThis is the receptor for interleukin-5. The alpha chain binds to IL5.
  • Tissue specificityExpressed on eosinophils and basophils.
  • Sequence similaritiesBelongs to the type I cytokine receptor family. Type 5 subfamily.
  • DomainThe WSXWS motif appears to be necessary for proper protein folding and thereby efficient intracellular transport and cell-surface receptor binding.
    The box 1 motif is required for JAK interaction and/or activation.
  • Cellular localizationMembrane.
  • Information by UniProt

Recombinant Human IL5RA protein (Fc Chimera) images

  • 1D SDS-PAGE of ab83828 before and after treatment with glycosidases to remove oligosaccharides.
    Lane 1: ab83828
    Lane 2: ab83828 treated with PNGase F to remove potential N-linked glycans
    Lane 3: ab83828 treated with a glycosidase cocktail to remove potential N- and O-linked glycans.
    10 μg protein loaded per lane; Deep Purple™ stained.
  • A sample of ab83828 without carrier protein was reduced and alkylated and focused on a 3-10 IPG strip then run on a 4-20% Tris-HCl 2D gel. 40 μg protein loaded per lane; Deep Purple™ stained.
  • Densitometry of protein isoforms visualised by 2-DE.
    The densitometry scan demonstrates the purified Human cell expressed protein exists in multiple isoforms, which differ according to their level of post-translational modification.
    The triangle indicates the theoretical MW and pI of the protein.

References for Recombinant Human IL5RA protein (Fc Chimera) (ab83828)

ab83828 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab83828.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"