Recombinant human IL6 protein (ab119444)

Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionP05231
    • SpeciesHuman
    • SequencePVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMC ESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEY LQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTK LQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM
    • Molecular weight21 kDa

Specifications

Our Abpromise guarantee covers the use of ab119444 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity>1 x 107 units/mg.
    ab119444 ED50 is 0.1ng/ml when assayed by proliferation of murine 7TD1 cells
  • Applications

    Western blot

    ELISA

    Functional Studies

    SDS-PAGE

    HPLC

  • Purity> 95 % SDS-PAGE.
    Endotoxin Level: <0.1 ng/ug
  • FormLyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. After reconstitution store at -20ºC. Avoid freeze / thaw cycles.

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • ReconstitutionReconstitute with 50ul distilled water. Care should be taken during reconstitution as the protein may appear as a film at the bottom of the vial. We recommend that the vial is gently mixed after reconstitution. DO NOT VORTEX. For long term storage the addition of 0.09% sodium azide is recommended. N.B. For functional studies do not add sodium azide.

General Info

  • Alternative names
    • Interleukin BSF 2
    • B cell differentiation factor
    • B cell stimulatory factor 2
    • B-cell stimulatory factor 2
    • BSF 2
    • BSF-2
    • BSF2
    • CDF
    • CTL differentiation factor
    • Hepatocyte stimulatory factor
    • HGF
    • HSF
    • Hybridoma growth factor
    • Hybridoma growth factor Interferon beta-2
    • IFN-beta-2
    • IFNB2
    • IL 6
    • IL-6
    • IL6
    • IL6_HUMAN
    • Interferon beta 2
    • Interferon beta-2
    • Interleukin 6
    • Interleukin 6 (interferon beta 2)
    • Interleukin BSF 2
    • Interleukin-6
    see all
  • FunctionCytokine with a wide variety of biological functions. It is a potent inducer of the acute phase response. Plays an essential role in the final differentiation of B-cells into Ig-secreting cells Involved in lymphocyte and monocyte differentiation. It induces myeloma and plasmacytoma growth and induces nerve cells differentiation Acts on B-cells, T-cells, hepatocytes, hematopoeitic progenitor cells and cells of the CNS. Also acts as a myokine. It is discharged into the bloodstream after muscle contraction and acts to increase the breakdown of fats and to improve insulin resistance.
  • Involvement in diseaseGenetic variations in IL6 are associated with susceptibility to rheumatoid arthritis systemic juvenile (RASJ) [MIM:604302]. An inflammatory articular disorder with systemic-onset beginning before the age of 16. It represents a subgroup of juvenile arthritis associated with severe extraarticular features and occasionally fatal complications. During active phases of the disorder, patients display a typical daily spiking fever, an evanescent macular rash, lymphadenopathy, hepatosplenomegaly, serositis, myalgia and arthritis.
    Note=A IL6 promoter polymorphism is associated with a lifetime risk of development of Kaposi sarcoma in HIV-infected men.
  • Sequence similaritiesBelongs to the IL-6 superfamily.
  • Post-translational
    modifications
    N- and O-glycosylated.
  • Cellular localizationSecreted.
  • Information by UniProt

References for Recombinant human IL6 protein (ab119444)

ab119444 has not yet been referenced specifically in any publications.

Product Wall

Thank you for contacting us.

I have heard back from the lab. They've advised me that their coating buffer is standard PBS (rather than alkaline carbonate buffers). Thus, your customer may wish to use PBS for coating instead.

I hop...

Read More

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"