Overview

Description

  • Nature
    Recombinant
  • Source
    Mammalian
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      DCDIEGKDGKQYESVLMVSIDQLLDSMKEIGSNCLNNEFNFFKRHICDAN KEGMFLFRAARKLRQFLKMNSTGDFDLHLLKVSEGTTILLNCTGQVKGRK PAALGEAQPTKSLEENKSLKEQKKLNDLCFLKRLLQEIKTCWNKILMGTK EHVDHHHHHH
    • Molecular weight
      18 kDa including tags
    • Amino acids
      26 to 177
    • Tags
      His tag C-Terminus
    • Additional sequence information
      Mature protein.

Specifications

Our Abpromise guarantee covers the use of ab185424 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    HPLC

    SDS-PAGE

  • Endotoxin level
    < 1.000 Eu/µg
  • Purity
    >95% by SDS-PAGE .
    Purity is greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
  • Form
    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. The lyophilized protein is stable for a few weeks at room temperature. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.4
    Constituents: 0.88% Sodium chloride, 99% Phosphate Buffer

  • Reconstitution
    Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 3X PBS. Please aliquot the reconstituted solution store at < -20 degrees, avoid freeze/thaw cycles.

General Info

  • Alternative names
    • IL 7
    • IL-7
    • Il7
    • IL7_HUMAN
    • Interleukin 7
    • Interleukin-7
    • LP-1
    • Lymphopoietin 1
    see all
  • Function
    Hematopoietic growth factor capable of stimulating the proliferation of lymphoid progenitors. It is important for proliferation during certain stages of B-cell maturation.
  • Sequence similarities
    Belongs to the IL-7/IL-9 family.
  • Cellular localization
    Secreted.
  • Information by UniProt

References

ab185424 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab185424.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up