Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      QQAPLGQHQLPIKTVTQNGTHVASVPTAVHGQVNNAAASPLHMLATHASA SASLPTKRHNGDQPEQPELKRIKTEDGEGIVIALSVDTPPAAVREKGVQN
    • Molecular weight
      37 kDa including tags
    • Amino acids
      561 to 660

Specifications

Our Abpromise guarantee covers the use of ab116830 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Cellular transcription factor ILF 1
    • Cellular transcription factor ILF-1
    • Cellular transcription factor ILF1
    • Forkhead box K2
    • Forkhead box protein K2
    • FOX K1
    • FOX K2
    • FOXK 1
    • FOXK 2
    • FOXK1
    • foxk2
    • FOXK2_HUMAN
    • ILF
    • ILF 1
    • Interleukin enhancer binding factor 1
    • Interleukin enhancer-binding factor 1
    see all
  • Function
    Recognizes the core sequence 5'-TAAACA-3'. Binds to NFAT-like motifs (purine-rich) in the IL2 promoter. Also binds to HIV-1 long terminal repeat. May be involved in both positive and negative regulation of important viral and cellular promoter elements.
  • Tissue specificity
    Expressed in both lymphoid and non-lymphoid cells.
  • Sequence similarities
    Contains 1 FHA domain.
    Contains 1 fork-head DNA-binding domain.
  • Domain
    The C-terminal part of the DNA-binding domain may contribute to DNA recognition specificity.
  • Post-translational
    modifications
    Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE stained with Coomassie Blue showing ab116830

References

ab116830 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab116830.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up