Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      QQAPLGQHQLPIKTVTQNGTHVASVPTAVHGQVNNAAASPLHMLATHASA SASLPTKRHNGDQPEQPELKRIKTEDGEGIVIALSVDTPPAAVREKGVQN
    • Molecular weight
      37 kDa including tags
    • Amino acids
      561 to 660

Specifications

Our Abpromise guarantee covers the use of ab116830 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Cellular transcription factor ILF 1
    • Cellular transcription factor ILF-1
    • Cellular transcription factor ILF1
    • Forkhead box K2
    • Forkhead box protein K2
    • FOX K1
    • FOX K2
    • FOXK 1
    • FOXK 2
    • FOXK1
    • foxk2
    • FOXK2_HUMAN
    • ILF
    • ILF 1
    • Interleukin enhancer binding factor 1
    • Interleukin enhancer-binding factor 1
    see all
  • Function
    Recognizes the core sequence 5'-TAAACA-3'. Binds to NFAT-like motifs (purine-rich) in the IL2 promoter. Also binds to HIV-1 long terminal repeat. May be involved in both positive and negative regulation of important viral and cellular promoter elements.
  • Tissue specificity
    Expressed in both lymphoid and non-lymphoid cells.
  • Sequence similarities
    Contains 1 FHA domain.
    Contains 1 fork-head DNA-binding domain.
  • Domain
    The C-terminal part of the DNA-binding domain may contribute to DNA recognition specificity.
  • Post-translational
    modifications
    Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Recombinant Human ILF1 protein images

  • 12.5% SDS-PAGE stained with Coomassie Blue showing ab116830

References for Recombinant Human ILF1 protein (ab116830)

ab116830 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab116830.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up