Overview

  • Product name
    Recombinant Human IMP3 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MNKLYIGNLSENAAPSDLESIFKDAKIPVSGPFLVKTGHAFVDCPDESWA LKAIEALSGKIELHGKPIEVEHSVPKRQRIRKLQIRNIPPHLQWEVLDSL LVQYGVVESCEQVNTDSETAVVNVTYSSKDQARQALDKLNGFQLENFTLK VAYIPDEMAAQQNPLQQPRGRRGLGQRGSSRQGSPGSVSKQKPCDLPLRL LVPTQFVGAIIGKEGATIRNITKQTQSKIDVHRKENAGAAEKSITILSTP EGTSAACKSILEIMHKEAQDIKFTEEIPLKILAHNNFVGRLIGKEGRNLK KIEQDTDTKITISPLQELTLYNPERTITVKGNVETCAKAEEEIMKKIRES YENDIASMNLQAHLIPGLNLNALGLFPPTSGMPPPTSGPPSAMTPPYPQF EQSETETVHLFIPALSVGAIIGKQGQHIKQLSRFAGASIKIAPAEAPDAK VRMVIITGPPEAQFKAQGRIYGKIKEENFVSPKEEVKLEAHIRVPSFAAG RVIGKGGKTVNELQNLSSAEVVVPRDQTPDENDQVVVKITGHFYACQVAQ RKIQEILTQVKQHQQQKALQSGPPQSRRK
    • Amino acids
      1 to 579
    • Tags
      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153106 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Cancer/testis antigen 98
    • CT98
    • DKFZp686F1078
    • hKOC
    • IF2B3_HUMAN
    • IGF II mRNA binding protein 3
    • IGF-II mRNA-binding protein 3
    • IGF2 mRNA binding protein 3
    • IGF2 mRNA-binding protein 3
    • IGF2BP3
    • IMP 3
    • IMP-3
    • Insulin like growth factor 2 mRNA binding protein 3
    • Insulin-like growth factor 2 mRNA-binding protein 3
    • KH domain containing protein overexpressed in cancer
    • KH domain-containing protein overexpressed in cancer
    • KOC 1
    • KOC1
    • VICKZ 3
    • VICKZ family member 3
    • VICKZ3
    see all
  • Function
    RNA-binding protein that act as a regulator of mRNA translation and stability. Binds to the 5'-UTR of the insulin-like growth factor 2 (IGF2) mRNAs. Binds to sequences in the 3'-UTR of CD44 mRNA.
  • Tissue specificity
    Expressed in fetal liver, fetal lung, fetal kidney, fetal thymus, fetal placenta, fetal follicles of ovary and gonocytes of testis, growing oocytes, spermatogonia and semen (at protein level). Expressed in cervix adenocarcinoma, in testicular, pancreatic and renal-cell carcinomas (at protein level). Expressed ubiquitously during fetal development at 8 and 14 weeks of gestation. Expressed in ovary, testis, brain, placenta, pancreatic cancer tissues and pancreatic cancer cell lines.
  • Sequence similarities
    Belongs to the RRM IMP/VICKZ family.
    Contains 4 KH domains.
    Contains 2 RRM (RNA recognition motif) domains.
  • Domain
    The third and fourth KH domains are important for binding to the untranslated region (UTR) of target mRNA.
  • Cellular localization
    Nucleus. Cytoplasm. Found in lamellipodia of the leading edge, in the perinuclear region, and beneath the plasma membrane. The subcytoplasmic localization is cell specific and regulated by cell contact and growth. Localized at the connecting piece and the tail of the spermatozoa. Colocalized with CD44 mRNA in RNP granules.
  • Information by UniProt

Images

  • ab153106 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab153106 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153106.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up