Recombinant Human IMPDH2 protein (ab113608)

Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionP12268
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMADYLISGGTSYVPDDGLTAQQLFNCGDGL TYNDFLILPGYIDFTADQVDLTSALTKKITLKTPLVSSPMDTVTEAGMAI AMALTGGIGFIHHNCTPEFQANEVRKVKKYEQGFITDPVVLSPKDRVRDV FEAKARHGFCGIPITDTGRMGSRLVGIISSRDIDFLKEEEHDCFLEEIMT KREDLVVAPAGITLKEANEILQRSKKGKLPIVNEDDELVAIIARTDLKKN RDYPLASKDAKKQLLCGAAIGTHEDDKYRLDLLAQAGVDVVVLDSSQGNS IFQINMIKYIKDKYPNLQVIGGNVVTAAQAKNLIDAGVDALRVGMGSGSI CITQEVLACGRPQATAVYKVSEYARRFGVPVIADGGIQNVGHIAKALALG ASTVMMGSLLAATTEAPGEYFFSDGIRLKKYRGMGSLDAMDKHLSSQNRY FSEADKIKVAQGVSGAVQDKGSIHKFVPYLIAGIQHSCQDIGAKSLTQVR AMMYSGELKFEKRTSSAQVEGGVHSLHSYEKRLF
    • Molecular weight58 kDa including tags
    • Amino acids1 to 514
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab113608 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity> 90 % SDS-PAGE.
    ab113608 was purified using conventional chromatography.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 0.03% DTT, 20% Glycerol, 0.88% Sodium chloride

General Info

  • Alternative names
    • IMDH2_HUMAN
    • IMP (inosine monophosphate) dehydrogenase 2
    • IMP dehydrogenase 2
    • IMP oxireductase 2
    • IMPD 2
    • IMPD2
    • IMPDH 2
    • IMPDH II
    • IMPDH-II
    • Impdh2
    • Inosine 5' monophosphate dehydrogenase 2
    • Inosine 5' phosphate dehydrogenase 2
    • Inosine monophosphate dehydrogenase type II
    • Inosine-5''-monophosphate dehydrogenase 2
    see all
  • FunctionRate limiting enzyme in the de novo synthesis of guanine nucleotides and therefore is involved in the regulation of cell growth. It may also have a role in the development of malignancy and the growth progression of some tumors.
  • Tissue specificityIMP type I is the main species in normal leukocytes and type II predominates over type I in the tumor.
  • PathwayPurine metabolism; XMP biosynthesis via de novo pathway; XMP from IMP: step 1/1.
  • Sequence similaritiesBelongs to the IMPDH/GMPR family.
    Contains 2 CBS domains.
  • Post-translational
    modifications
    The N-terminus is blocked.
  • Information by UniProt

Recombinant Human IMPDH2 protein images

  • 15% SDS-PAGE analysis of ab113608 (3µg)

References for Recombinant Human IMPDH2 protein (ab113608)

ab113608 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab113608.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"