Recombinant Human IMPDH2 protein (ab185401)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMADYLISGGTSYVPDDGLTAQQLFNCGDGL TYNDFLILPGYIDFTADQVDLTSALTKKITLKTPLVSSPMDTVTEAGMAI AMALTGGIGFIHHNCTPEFQANEVRKVKKYEQGFITDPVVLSPKDRVRDV FEAKARHGFCGIPITDTGRMGSRLVGIISSRDIDFLKEEEHDCFLEEIMT KREDLVVAPAGITLKEANEILQRSKKGKLPIVNEDDELVAIIARTDLKKN RDYPLASKDAKKQLLCGAAIGTHEDDKYRLDLLAQAGVDVVVLDSSQGNS IFQINMIKYIKDKYPNLQVIGGNVVTAAQAKNLIDAGVDALRVGMGSGSI CITQEVLACGRPQATAVYKVSEYARRFGVPVIADGGIQNVGHIAKALALG ASTVMMGSLLAATTEAPGEYFFSDGIRLKKYRGMGSLDAMDKHLSSQNRY FSEADKIKVAQGVSGAVQDKGSIHKFVPYLIAGIQHSCQDIGAKSLTQVR AMMYSGELKFEKRTSSAQVE GGVHSLHSYEKRLF
    • Molecular weight
      58 kDa including tags
    • Amino acids
      1 to 514
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab185401 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Endotoxin level
    < 1.000 Eu/µg
  • Purity
    >95% by SDS-PAGE .
    Purity is determined by SEC-HPLC and reducing SDS-PAGE.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.24% Tris, 0.88% Sodium chloride

General Info

  • Alternative names
    • IMDH2_HUMAN
    • IMP (inosine monophosphate) dehydrogenase 2
    • IMP dehydrogenase 2
    • IMP oxireductase 2
    • IMPD 2
    • IMPD2
    • IMPDH 2
    • IMPDH II
    • IMPDH-II
    • Impdh2
    • Inosine 5' monophosphate dehydrogenase 2
    • Inosine 5' phosphate dehydrogenase 2
    • Inosine monophosphate dehydrogenase type II
    • Inosine-5''-monophosphate dehydrogenase 2
    see all
  • Function
    Rate limiting enzyme in the de novo synthesis of guanine nucleotides and therefore is involved in the regulation of cell growth. It may also have a role in the development of malignancy and the growth progression of some tumors.
  • Tissue specificity
    IMP type I is the main species in normal leukocytes and type II predominates over type I in the tumor.
  • Pathway
    Purine metabolism; XMP biosynthesis via de novo pathway; XMP from IMP: step 1/1.
  • Sequence similarities
    Belongs to the IMPDH/GMPR family.
    Contains 2 CBS domains.
  • Post-translational
    modifications
    The N-terminus is blocked.
  • Information by UniProt

References

ab185401 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab185401.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up