Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MADKVLKEKRKQFIRSVGEGTINGLLGELLETRVLSQEEIEIVKCENATV MDKARALLDSVIRKGAPACQICITYICEEDSHLAGTLGLSAGPTSGNHLT TQDSQIVLPS
    • Amino acids
      1 to 110
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab166532 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CAR17_HUMAN
    • CARD 17
    • CARD17
    • Caspase 1 inhibitor
    • Caspase recruitment domain containing protein 17
    • Caspase recruitment domain-containing protein 17
    • Caspase-1 inhibitor INCA
    • Caspase1 inhibitor
    • Inhibitory caspase recruitment domain (CARD) protein
    • Inhibitory caspase recruitment domain protein
    see all
  • Function
    Regulator of procaspase-1/CASP1 activation implicated in the regulation of the proteolytic maturation of pro-IL-1beta/IL1B and its release during inflammation. Inhibits the release of IL1B in response to LPS in monocytes. However, unlike CASP1, do not induce NF-kappa-B activation.
  • Tissue specificity
    Ubiquitous.
  • Sequence similarities
    Contains 1 CARD domain.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt

Images

  • ab166532 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab166532 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab166532.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up