Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMGSMADKVLKEKRKQFIRSVGEGTINGLLG ELLETRVLSQEEIEIVKCENATVMDKARALLDSVIRKGAPACQICITYIC EEDSHLAGTLGLSAGPTSGNHLTTQDSQIVLPS
    • Molecular weight
      14 kDa including tags
    • Amino acids
      1 to 110
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab171673 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    >95% by SDS-PAGE .
    ab171673 was purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.02% DTT, 0.32% Tris HCl, 20% Glycerol, 0.88% Sodium chloride

General Info

  • Alternative names
    • CAR17_HUMAN
    • CARD 17
    • CARD17
    • Caspase 1 inhibitor
    • Caspase recruitment domain containing protein 17
    • Caspase recruitment domain-containing protein 17
    • Caspase-1 inhibitor INCA
    • Caspase1 inhibitor
    • Inhibitory caspase recruitment domain (CARD) protein
    • Inhibitory caspase recruitment domain protein
    see all
  • Function
    Regulator of procaspase-1/CASP1 activation implicated in the regulation of the proteolytic maturation of pro-IL-1beta/IL1B and its release during inflammation. Inhibits the release of IL1B in response to LPS in monocytes. However, unlike CASP1, do not induce NF-kappa-B activation.
  • Tissue specificity
    Ubiquitous.
  • Sequence similarities
    Contains 1 CARD domain.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of ab171673 (3µg).

References

ab171673 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab171673.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up