Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MLGQQQQQLYSSAALLTGERSRLLTCYVQDYLECVESLPHDMQRNVSVLR ELDNKYQETLKEIDDVYEKYKKEDDLNQKKRLQQLLQRALINSQELGDEK IQIVTQMLELVENRARQMELHSQCFQDPAESERASDKAKMDSSQPERSSR RPRRQRTSESRDLCHMANGIEDCDDQPPKEKKSKSAKKKKRSKAKQEREA SPVEFAIDPNEPTYCLCNQVSYGEMIGCDNEQCPIEWFHFSCVSLTYKPK GKWYCPKCRGDNEKTMGKSTEKTKKDRRSR
    • Molecular weight
      57 kDa including tags
    • Amino acids
      1 to 280

Specifications

Our Abpromise guarantee covers the use of ab116739 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

    SDS-PAGE

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    This protein is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.3% Glutathione

General Info

  • Alternative names
    • ING 1 like tumor suppressor protein
    • ING 1L
    • ING 2
    • ING1 like tumor suppressor protein
    • ING1L
    • ING1Lp
    • ING2
    • ING2_HUMAN
    • Inhibitor of growth 1 like
    • Inhibitor of growth 1 like protein
    • Inhibitor of growth 1-like protein
    • Inhibitor of growth family member 1 like
    • Inhibitor of growth family member 2
    • Inhibitor of growth protein 2
    • p32
    • p33 ING2
    • p33ING2
    see all
  • Function
    Seems to be involved in p53/TP53 activation and p53/TP53-dependent apoptotic pathways, probably by enhancing acetylation of p53/TP53. Component of a mSin3A-like corepressor complex, which is probably involved in deacetylation of nucleosomal histones. ING2 activity seems to be modulated by binding to phosphoinositides (PtdInsPs).
  • Tissue specificity
    Widely expressed. Higher expressed in colon-cancer tumor than in normal colon tissues.
  • Sequence similarities
    Belongs to the ING family.
    Contains 1 PHD-type zinc finger.
  • Domain
    The PHD-type zinc finger domain binds to phosphoinositides (PtdInsPs), including phosphatidylinositol 5-phosphate (PtdIns(5)P).
  • Cellular localization
    Nucleus. Predominantly nuclear. Localized to chromatin and nuclear matrix. Upon reduced PtdIns(5)P levels seems to be released from chromatin and, at least partially, translocated to the cytoplasm.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE of ab116739 stained with Coomassie Blue.

References

ab116739 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab116739.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up