Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionQ9H160
    • SpeciesHuman
    • SequenceMLGQQQQQLYSSAALLTGERSRLLTCYVQDYLECVESLPHDMQRNVSVLR ELDNKYQETLKEIDDVYEKYKKEDDLNQKKRLQQLLQRALINSQELGDEK IQIVTQMLELVENRARQMELHSQCFQDPAESERASDKAKMDSSQPERSSR RPRRQRTSESRDLCHMANGIEDCDDQPPKEKKSKSAKKKKRSKAKQEREA SPVEFAIDPNEPTYCLCNQVSYGEMIGCDNEQCPIEWFHFSCVSLTYKPK GKWYCPKCRGDNEKTMGKSTEKTKKDRRSR
    • Molecular weight57 kDa including tags
    • Amino acids1 to 280

Specifications

Our Abpromise guarantee covers the use of ab116739 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

    SDS-PAGE

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    This protein is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.3% Glutathione

General Info

  • Alternative names
    • ING 1 like tumor suppressor protein
    • ING 1L
    • ING 2
    • ING1 like tumor suppressor protein
    • ING1L
    • ING1Lp
    • ING2
    • ING2_HUMAN
    • Inhibitor of growth 1 like
    • Inhibitor of growth 1 like protein
    • Inhibitor of growth 1-like protein
    • Inhibitor of growth family member 1 like
    • Inhibitor of growth family member 2
    • Inhibitor of growth protein 2
    • p32
    • p33 ING2
    • p33ING2
    see all
  • FunctionSeems to be involved in p53/TP53 activation and p53/TP53-dependent apoptotic pathways, probably by enhancing acetylation of p53/TP53. Component of a mSin3A-like corepressor complex, which is probably involved in deacetylation of nucleosomal histones. ING2 activity seems to be modulated by binding to phosphoinositides (PtdInsPs).
  • Tissue specificityWidely expressed. Higher expressed in colon-cancer tumor than in normal colon tissues.
  • Sequence similaritiesBelongs to the ING family.
    Contains 1 PHD-type zinc finger.
  • DomainThe PHD-type zinc finger domain binds to phosphoinositides (PtdInsPs), including phosphatidylinositol 5-phosphate (PtdIns(5)P).
  • Cellular localizationNucleus. Predominantly nuclear. Localized to chromatin and nuclear matrix. Upon reduced PtdIns(5)P levels seems to be released from chromatin and, at least partially, translocated to the cytoplasm.
  • Information by UniProt

Recombinant Human ING2 protein images

  • 12.5% SDS-PAGE of ab116739 stained with Coomassie Blue.

References for Recombinant Human ING2 protein (ab116739)

ab116739 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab116739.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"