Recombinant Human INPP5A protein (ab116980)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      YFNQEVFRDNNGTALLEFDKELSVFKDRLYELDISFPPSYPYSEDARQGE QYMNTRCPAWCDRILMSPSAKELVLRVSVCCPSPGHRGMWSAGSGLAQPW
    • Molecular weight
      37 kDa including tags
    • Amino acids
      288 to 387

Specifications

Our Abpromise guarantee covers the use of ab116980 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 4
    • 43 kDa inositol polyphosphate 5-phophatase
    • 5-trisphosphate 5-phosphatase
    • 5PTase
    • CTCL tumor antigen HD-CL-02
    • DKFZp434A1721
    • I5P1
    • I5P1_HUMAN
    • Inositol polyphosphate 5 phosphatase
    • inositol polyphosphate-5-phosphatase A
    • inositol trisphosphate-5-phosphatase
    • INPP5A
    • INPP5A inositol polyphosphate-5-phosphatase
    • InsP3 5-phosphatase
    • MGC116947
    • MGC116949
    • Type I inositol-1
    • type I inositol-1,4,5-trisphosphate 5-phophatase
    see all
  • Function
    Major isoenzyme hydrolyzing the calcium-mobilizing second messenger Ins(1,4,5)P3, this is a signal-terminating reaction.
  • Tissue specificity
    Brain; high level in Purkinje cells.
  • Sequence similarities
    Belongs to the inositol-1,4,5-trisphosphate 5-phosphatase type I family.
  • Cellular localization
    Membrane.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE Stained with Coomassie Blue.

References

ab116980 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab116980.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up