Recombinant Human INPP5A protein (ab116980)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      YFNQEVFRDNNGTALLEFDKELSVFKDRLYELDISFPPSYPYSEDARQGE QYMNTRCPAWCDRILMSPSAKELVLRVSVCCPSPGHRGMWSAGSGLAQPW
    • Molecular weight
      37 kDa including tags
    • Amino acids
      288 to 387

Specifications

Our Abpromise guarantee covers the use of ab116980 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 4
    • 43 kDa inositol polyphosphate 5-phophatase
    • 5-trisphosphate 5-phosphatase
    • 5PTase
    • CTCL tumor antigen HD-CL-02
    • DKFZp434A1721
    • I5P1
    • I5P1_HUMAN
    • Inositol polyphosphate 5 phosphatase
    • inositol polyphosphate-5-phosphatase A
    • inositol trisphosphate-5-phosphatase
    • INPP5A
    • INPP5A inositol polyphosphate-5-phosphatase
    • InsP3 5-phosphatase
    • MGC116947
    • MGC116949
    • Type I inositol-1
    • type I inositol-1,4,5-trisphosphate 5-phophatase
    see all
  • Function
    Major isoenzyme hydrolyzing the calcium-mobilizing second messenger Ins(1,4,5)P3, this is a signal-terminating reaction.
  • Tissue specificity
    Brain; high level in Purkinje cells.
  • Sequence similarities
    Belongs to the inositol-1,4,5-trisphosphate 5-phosphatase type I family.
  • Cellular localization
    Membrane.
  • Information by UniProt

Recombinant Human INPP5A protein images

  • 12.5% SDS-PAGE Stained with Coomassie Blue.

References for Recombinant Human INPP5A protein (ab116980)

ab116980 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab116980.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up