Overview

  • Product name
    Recombinant Human INSL5 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MKGSIFTLFLFSVLFAISEVRSKESVRLCGLEYIRTVIYICASSRWRRHL EGIPQAQQAETGNSFQLPHKREFSEENPAQNLPKVDASGEDRLWGGQMPT EELWKSKKHSVMSRQDLQTLCCTDGCSMTDLSALC
    • Amino acids
      1 to 135
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153037 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • INSL5
    • INSL5_HUMAN
    • Insulin like peptide INSL5
    • Insulin-like peptide 5
    • Insulin-like peptide INSL5 A chain
    • MGC126695
    • MGC126697
    • PRO182
    • RIF2
    • RP24-72J16.1
    • UNQ156
    • UNQ156/PRO182
    see all
  • Function
    May have a role in gut contractility or in thymic development and regulation. Activates RXFP4 with high potency and appears to be the endogenous ligand for this receptor.
  • Tissue specificity
    Highly expressed in rectum with lower levels in uterus and ascending and descending colon.
  • Sequence similarities
    Belongs to the insulin family.
  • Cellular localization
    Secreted.
  • Information by UniProt

Images

  • ab153037 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab153037 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153037.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up