Recombinant Human Integrin alpha 1 protein (ab112310)

Overview

  • Product nameRecombinant Human Integrin alpha 1 protein
  • Protein lengthProtein fragment

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP56199
    • SpeciesHuman
    • SequenceQFYSSASEYHISIAANETVPEVINSTEDIGNEINIFYLIRKSGSFPMPEL KLSISFPNMTSNGYPVLYPTGLSSSENANCRPHIFEDPFSINSGKKMTTS TDHLKRGTI
    • Molecular weight38 kDa including tags
    • Amino acids951 to 1059

Specifications

Our Abpromise guarantee covers the use of ab112310 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

    SDS-PAGE

  • FormLiquid
  • Additional notesab112310 is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.31% Glutathione

General Info

  • Alternative names
    • CD 49a
    • CD49 antigen-like family member A
    • CD49a
    • CD49a antigen
    • Integrin alpha-1
    • ITA1_HUMAN
    • Itga 1
    • ITGA1
    • Laminin and collagen receptor
    • Very late activation protein 1
    • VLA 1
    • VLA-1
    • VLA1
    see all
  • FunctionIntegrin alpha-1/beta-1 is a receptor for laminin and collagen. It recognizes the proline-hydroxylated sequence G-F-P-G-E-R in collagen.
  • Sequence similaritiesBelongs to the integrin alpha chain family.
    Contains 7 FG-GAP repeats.
    Contains 1 VWFA domain.
  • DomainThe integrin I-domain (insert) is a VWFA domain. Integrins with I-domains do not undergo protease cleavage.
  • Cellular localizationMembrane.
  • Information by UniProt

Recombinant Human Integrin alpha 1 protein images

  • 12.5% SDS-PAGE showing ab112310 stained with Coomassie Blue.

References for Recombinant Human Integrin alpha 1 protein (ab112310)

This product has been referenced in:
  • Chang BS  et al. Collagen complexes increase the efficiency of iPS cells generated using fibroblasts from adult mice. J Reprod Dev 61:145-53 (2015). WB ; Mouse . Read more (PubMed: 25740096) »

See 1 Publication for this product

Product Wall

Thank you very much for your interest in ab112310, anti-Integrin alpha 1.

To our knowledge, this antibody has not been tested in SPR. Therefore, I can offer a discount off a future purchase if you buy ab112310 now, test it in SPRand submit fee...

Read More

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"