Recombinant Human Integrin alpha 2 protein (ab158772)

Overview

  • Product name
    Recombinant Human Integrin alpha 2 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      YNVGLPEAKIFSGPSSEQFGYAVQQFINPKGNWLLVGSPWSGFPENRMGD VYKCPVDLSTATCEKLNLQTSTSIPNVTEMKTNMSLGLIL
    • Amino acids
      30 to 119
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158772 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • BR
    • CD 49b
    • CD49 antigen like family member B
    • CD49 antigen-like family member B
    • CD49b
    • CD49b antigen
    • Collagen receptor
    • DX5
    • Glycoprotein Ia deficiency included
    • GP Ia
    • GP Ia deficiency, included
    • GPIa
    • HPA 5 included
    • HPA5 included
    • Human platelet alloantigen system 5
    • Integrin alpha 2
    • Integrin alpha II
    • Integrin alpha-2
    • Integrin, alpha 2 (CD49B alpha 2 subunit of VLA 2 receptor)
    • ITA2_HUMAN
    • ITGA2
    • Platelet alloantigen Br(a), included
    • Platelet antigen Br
    • Platelet glycoprotein GPIa
    • Platelet glycoprotein Ia
    • Platelet glycoprotein Ia/IIa
    • Platelet membrane glycoprotein Ia
    • Platelet receptor for collagen, deficiency of, included
    • Very late activation protein 2 receptor alpha 2 subunit
    • VLA 2
    • VLA 2 alpha chain
    • VLA 2 subunit alpha
    • VLA-2 subunit alpha
    • VLA2
    • VLA2 receptor alpha 2 subunit
    • VLAA2
    see all
  • Function
    Integrin alpha-2/beta-1 is a receptor for laminin, collagen, collagen C-propeptides, fibronectin and E-cadherin. It recognizes the proline-hydroxylated sequence G-F-P-G-E-R in collagen. It is responsible for adhesion of platelets and other cells to collagens, modulation of collagen and collagenase gene expression, force generation and organization of newly synthesized extracellular matrix.
  • Sequence similarities
    Belongs to the integrin alpha chain family.
    Contains 7 FG-GAP repeats.
    Contains 1 VWFA domain.
  • Domain
    The integrin I-domain (insert) is a VWFA domain. Integrins with I-domains do not undergo protease cleavage.
  • Cellular localization
    Membrane.
  • Information by UniProt

Images

  • ab158772 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158772 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158772.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up