Recombinant Human Interferon alpha10 protein (ab158734)

Overview

  • Product name
    Recombinant Human Interferon alpha10 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MALSFSLLMAVLVLSYKSICSLGCDLPQTHSLGNRRALILLGQMGRISPF SCLKDRHDFRIPQEEFDGNQFQKAQAISVLHEMIQQTFNLFSTEDSSAAW EQSLLEKFSTELYQQLNDLEACVIQEVGVEETPLMNEDSILAVRKYFQRI TLYLIERKYSPCAWEVVRAEIMRSLSFSTNLQKRLRRKD
    • Amino acids
      1 to 189
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158734 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • IFN-alpha-10
    • IFN10_HUMAN
    • IFNA10
    • Interferon alpha 6L
    • Interferon alpha C
    • Interferon alpha-10
    • Interferon alpha-6L
    • Interferon alpha-C
    • interferon, alpha 10
    • LeIF C
    • MGC119878
    • MGC119879
    see all
  • Function
    Produced by macrophages, IFN-alpha have antiviral activities. Interferon stimulates the production of two enzymes: a protein kinase and an oligoadenylate synthetase.
  • Sequence similarities
    Belongs to the alpha/beta interferon family.
  • Cellular localization
    Secreted.
  • Information by UniProt

Images

  • ab158734 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158734 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158734.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up