Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionQ14609
    • SpeciesHuman
    • SequenceMQDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQI VSFYFKLFKN FKDDQSIQKS VETIKEDMNV KFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKR KRSQMLFQGR RASQ
    • Molecular weight17 kDa
    • Amino acids1 to 144

Specifications

Our Abpromise guarantee covers the use of ab9659 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity

    The ED50 determined by a cytotoxicity assay using HT-29 cells is ≤0.05 ng/mL, corresponding to a specific activity of ≥ 2 x 107 units/mg.

     

  • Applications

    Functional Studies

    SDS-PAGE

  • Endotoxin level< 1.000 Eu/µg
  • Purity> 97 % SDS-PAGE.
    Sterile filtered. Greater than 97% by SDS-PAGE and HPLC analyses.
  • FormLyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    n/a

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • ReconstitutionReconstitute in 100ul PBS, pH 8.0 to a concentration of 1.0 mg/ml. Note: further dilutions should be made into RPMI + 10% FCS or 5% HAS and stored at 4 degrees C for 1 week or -20 degrees C for future use.

General Info

  • Alternative names
    • IFG
    • IFI
    • IFN gamma
    • IFN, immune
    • IFN-gamma
    • IFNG
    • IFNG_HUMAN
    • Immune interferon
    • Interferon gamma
    see all
  • FunctionProduced by lymphocytes activated by specific antigens or mitogens. IFN-gamma, in addition to having antiviral activity, has important immunoregulatory functions. It is a potent activator of macrophages, it has antiproliferative effects on transformed cells and it can potentiate the antiviral and antitumor effects of the type I interferons.
  • Tissue specificityReleased primarily from activated T lymphocytes.
  • Involvement in diseaseIn Caucasians, genetic variation in IFNG is associated with the risk of aplastic anemia (AA) [MIM:609135]. AA is a rare disease in which the reduction of the circulating blood cells results from damage to the stem cell pool in bone marrow. In most patients, the stem cell lesion is caused by an autoimmune attack. T-lymphocytes, activated by an endogenous or exogenous, and most often unknown antigenic stimulus, secrete cytokines, including IFN-gamma, which would in turn be able to suppress hematopoiesis.
  • Sequence similaritiesBelongs to the type II (or gamma) interferon family.
  • Post-translational
    modifications
    Proteolytic processing produces C-terminal heterogeneity, with proteins ending alternatively at Gly-150, Met-157 or Gly-161.
  • Cellular localizationSecreted.
  • Information by UniProt

References for Recombinant human Interferon gamma protein (ab9659)

This product has been referenced in:
  • Wu Z  et al. Oxidative stress modulates complement factor H expression in retinal pigmented epithelial cells by acetylation of FOXO3. J Biol Chem 282:22414-25 (2007). Read more (PubMed: 17558024) »

See 1 Publication for this product

Product Wall

There are currently no Abreviews or Questions for ab9659.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"