Recombinant Human Interleukin 34 protein (ab109933)

Overview

Description

  • Nature
    Recombinant
  • Source
    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      NEPLEMWPLTQNEECTVTGFLRDKLQYRSRLQYMKHYFPINYKISVPYEG VFRIANVTRLQRAQVSERELRYLWVLVSLSATESVQDVLLEGHPSWKYLQ EVETLLLNVQQGLTDVEVSPKVESVLSLLNAPGPNLKLVRPKALLDNCFR VMELLYCSCCKQSSVLNWQDCEVPSPQSCSPEPSLQYAATQLYPPPPWSP SSPPHSTGSVRPVRAQGEGLLPHHHHHHHH
    • Molecular weight
      53 kDa
    • Amino acids
      21 to 242
    • Tags
      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab109933 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Endotoxin level
    < 0.100 Eu/µg
  • Purity
    > 95 % SDS-PAGE.
    Purity is greater than 95% by SDS-PAGE gel and HPLC analyses.
  • Form
    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 3.00
    Constituents: 0.44% Sodium chloride, 0.52% Sodium citrate

  • Reconstitution
    Reconstitute in water to a concentration of 0.1-1.0 mg/ml for extended storage, it is recommended to further dilute in a buffer containing a carrier protein (example 0.1% BSA)

General Info

  • Alternative names
    • C16orf77
    • Chromosome 16 open reading frame 77
    • FPT025
    • IL 34
    • IL-34
    • Il34
    • IL34_HUMAN
    • Interleukin 34
    • Interleukin-34
    • Interleukin34
    • MGC34647
    see all
  • Function
    Cytokine that promotes the differentiation and viability of monocytes and macrophages. Stimulates phosphorylation of MAPK1/ERK2 AND MAPK3/ERK1. Ligand for colony-stimulating factor-1 receptor CSF1R.
  • Tissue specificity
    Detected in the sinusoidal epithelium in the red pulp of spleen (at protein level). Predominantly expressed in spleen. Also detected in a range of other tissues including heart, brain, lung, liver, kidney, thymus, testis, ovary, small intestine, prostate and colon.
  • Sequence similarities
    Belongs to the IL-34 family.
  • Cellular localization
    Secreted.
  • Information by UniProt

References for Recombinant Human Interleukin 34 protein (ab109933)

ab109933 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab109933.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up