Recombinant Human Interleukin 34 protein (ab109933)

Overview

Description

  • Nature
    Recombinant
  • Source
    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      NEPLEMWPLTQNEECTVTGFLRDKLQYRSRLQYMKHYFPINYKISVPYEG VFRIANVTRLQRAQVSERELRYLWVLVSLSATESVQDVLLEGHPSWKYLQ EVETLLLNVQQGLTDVEVSPKVESVLSLLNAPGPNLKLVRPKALLDNCFR VMELLYCSCCKQSSVLNWQDCEVPSPQSCSPEPSLQYAATQLYPPPPWSP SSPPHSTGSVRPVRAQGEGLLPHHHHHHHH
    • Molecular weight
      53 kDa
    • Amino acids
      21 to 242
    • Tags
      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab109933 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Endotoxin level
    < 0.100 Eu/µg
  • Purity
    > 95 % SDS-PAGE.
    Purity is greater than 95% by SDS-PAGE gel and HPLC analyses.
  • Form
    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 3.00
    Constituents: 0.44% Sodium chloride, 0.52% Sodium citrate

  • Reconstitution
    Reconstitute in water to a concentration of 0.1-1.0 mg/ml for extended storage, it is recommended to further dilute in a buffer containing a carrier protein (example 0.1% BSA)

General Info

  • Alternative names
    • C16orf77
    • Chromosome 16 open reading frame 77
    • FPT025
    • IL 34
    • IL-34
    • Il34
    • IL34_HUMAN
    • Interleukin 34
    • Interleukin-34
    • Interleukin34
    • MGC34647
    see all
  • Function
    Cytokine that promotes the differentiation and viability of monocytes and macrophages. Stimulates phosphorylation of MAPK1/ERK2 AND MAPK3/ERK1. Ligand for colony-stimulating factor-1 receptor CSF1R.
  • Tissue specificity
    Detected in the sinusoidal epithelium in the red pulp of spleen (at protein level). Predominantly expressed in spleen. Also detected in a range of other tissues including heart, brain, lung, liver, kidney, thymus, testis, ovary, small intestine, prostate and colon.
  • Sequence similarities
    Belongs to the IL-34 family.
  • Cellular localization
    Secreted.
  • Information by UniProt

References

ab109933 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab109933.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up