Recombinant Human Intersectin-2 protein (ab162345)

Overview

  • Product name
    Recombinant Human Intersectin-2 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      NQKNREQEEIVRLNSKKKNLHLELEALNGKHQQISGRLQDVRLKKQTQKT ELEVLDKQCDLEIMEIKQLQQELQEYQNKLIYLVPEKQLLNERIKNMQFS N
    • Amino acids
      471 to 571
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162345 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Intersectin-2
    • ITSN2
    • ITSN2_HUMAN
    • KIAA1256
    • PRO2015
    • SH3 domain-containing protein 1B
    • SH3D1B
    • SH3P18
    • SH3P18-like WASP-associated protein
    • SWA
    • SWAP
    see all
  • Function
    Adapter protein that may provide indirect link between the endocytic membrane traffic and the actin assembly machinery. May regulate the formation of clathrin-coated vesicles.
  • Tissue specificity
    Ubiquitous. Isoform 1 is primarily expressed in adult heart and liver.
  • Sequence similarities
    Contains 1 C2 domain.
    Contains 1 DH (DBL-homology) domain.
    Contains 2 EF-hand domains.
    Contains 2 EH domains.
    Contains 1 PH domain.
    Contains 5 SH3 domains.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt

Images

  • ab162345 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162345 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162345.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up